Abstract
Introduction:
Skeletal muscle satellite cells (MuSCs or stem cells) play a crucial role in muscle development, maintenance, and regeneration, supporting both hypertrophy and regenerative myogenesis. Syndecans (SDCs) act as communication bridges within the muscle microenvironment, regulating interactions with extracellular matrix components and contributing significantly to tissue repair and inflammation. Specifically, syndecan-4 (SDC4) is involved in muscle regeneration at multiple stages.
Methods:
This study delves into the emerging challenge of wooden breast (WB) myopathy and its connection with SDC4. Our hypothesis proposes that disruptions in MuSC dynamics through SDC4 contribute to the increased incidence of breast myopathies observed in growing broilers. To test our hypothesis, non-affected and affected broilers were systematically selected, and the characteristics of WB myopathy were studied both in vitro and in vivo. SDC4 overexpression in MuSCs and blocking peptides (BPs) corresponding to the SDC4 ectodomain were used for investigating the role of SDC4 in muscle development and its shedding levels.
Results and discussion:
In vivo examination of affected muscles revealed smaller fibers and changes in metabolic pathways. In vitro studies unveiled disrupted proliferation of MuSCs in WB myopathy, accompanied by the downregulation of several muscle markers. Investigation of the potential role of SDC4 in the pathogenesis of WB myopathy revealed a decreased tendency in SDC4 gene expression and increased shedding of its ectodomain. Moreover, we showed that SDC4 overexpression is linked to reduced proliferation in MuSCs and affected myogenesis. We detected an impaired proliferation of WB-affected MuSCs, revealing critical insights into the dysfunctional state of these cells in myopathy. Additionally, by treating MuSCs with blocking peptides derived from the SDC4 ectodomain, we identified altered proliferation. Taken together, this work contributes with valuable knowledge on the molecular mechanisms underlying WB myopathy and the role of SDC4 in this chicken myopathy.
1 Introduction
Commercial broiler chickens have undergone genetic selection for effective growth and higher breast muscle yield in response to increasing demand for poultry meat (Petracci and Cavani, 2012; Zuidhof et al., 2014; Petracci et al., 2015). However, this intensified selective breeding has led to an increase in production-related diseases, particularly wooden breast (WB) myopathy (Sihvo et al., 2014; Petracci et al., 2019). This condition predominantly affects the pectoralis major muscle in broiler chickens. WB myopathy results in firm, woody-like breast muscles, negatively affecting meat quality, animal welfare, and economic viability (Sihvo et al., 2014; Mudalal et al., 2015; Velleman, 2015; Velleman et al., 2019; Sanden et al., 2021).
Wooden breast is characterized by skeletal muscle fibrosis, necrosis, and multifocal degeneration of muscle tissue previously demonstrated both by us (Wold et al., 2017; Sanden et al., 2021; Pejšková et al., 2023) and others (Sihvo et al., 2014; Velleman and Clark, 2015; Soglia et al., 2016). Furthermore, the infiltration of inflammatory cells, muscle fiber myodegeneration with partial regeneration, reduced angiogenesis, and adipose infiltrations have also been demonstrated (Mutryn et al., 2015; Papah et al., 2017; Hosotani et al., 2020). The etiology of WB is still not completely identified, but hypoxia and oxidative stress are suggested as two major contributors to its onset (Hosotani et al., 2020; Bordini et al., 2024). Other mechanisms relevant to the onset and progression of WB include dysregulation of energy metabolism, mitochondrial, dysfunction, and a profound change in extracellular matrix composition (Hosotani et al., 2020; Young and Rasmussen, 2020).
Skeletal muscle satellite cells (MuSCs), also known as muscle stem cells, located between the basement membrane and the myofiber plasma membrane, are the primary contributors to postnatal growth, maintenance, and skeletal muscle regeneration (Ganassi et al., 2022; Careccia et al., 2024). MuSCs remain quiescent under normal conditions, interacting closely with myofibers and potentially with endothelial cells (Christov et al., 2007; Chakkalakal et al., 2012; Yin et al., 2013). In response to various stimuli and injuries, MuSCs become activated, proliferate, and differentiate, thus contributing to muscle tissue formation (Motohashi and Asakura, 2014; Mashinchian et al., 2018). The typical process of muscle fiber regeneration involves several sequential steps: initial inflammation accompanied by the removal of necrotic tissue, subsequent angiogenesis to re-establish blood flow, activation of MuSCs, migration and proliferation to the injured area, maturation of myotubes, and eventually innervation, leading to the formation of fully functional new muscle fibers (Tidball, 2011).
Myogenesis is regulated by a series of transcription factors, including Paired box 7 (PAX7), which is expressed in quiescent, activated, and proliferating MuSCs; myogenic factor 5 (MYF5), whose expression overlaps with PAX7 at the mRNA levels; and myogenic determination protein 1 homolog (MYOD1), which is expressed immediately after activation and continues through myotube formation (Zammit et al., 2006; Careccia et al., 2024). Once the cells progress through differentiation, other myogenic transcription factors, such as myogenin (MYOG) and different isoforms of skeletal muscle-specific myosin heavy chain 1B (MyH1B), are upregulated (Olguín and Pisconti, 2012; Careccia et al., 2024).
Regenerative mechanisms have been suggested to be impaired in chickens affected by WB syndrome (Velleman, 2015; Velleman, 2023), and modern commercial chickens experience decreased regeneration of damaged myofibers due to reduced MuSC myogenic activity in the pectoralis major muscle (Xu and Velleman, 2023). We have recently shown that the affected WB phenotype is characterized by more than 4,000 upregulated genes compared with the non-affected phenotype, as well as extensive extracellular matrix (ECM) remodeling, increased matrix metalloproteinase (MMP) activity, and altered expression and shedding levels of the syndecan protein family of four members (SDC1–4) (Pejšková et al., 2023).
SDCs are type I transmembrane proteins modified with glycosaminoglycan (GAG) chains, predominantly heparan sulfate, which play a pivotal role in mediating cell–cell and cell–matrix interactions (Couchman, 2010). Their cytoplasmic domains activate signaling pathways that regulate various cellular and transcriptional functions. As co-receptors, SDCs collaborate with integrins, growth factors, and other signaling molecules, influencing diverse biological processes such as cell adhesion, proliferation, differentiation, and ECM assembly (Afratis et al., 2017).
Moreover, SDCs are regulators of skeletal muscle growth and tissue repair (Pisconti et al., 2012; Rønning et al., 2015; Pisconti et al., 2016; Rønning et al., 2020; Jones et al., 2022; Sztretye et al., 2023), inflammation, and tumor progression, emphasizing their multifaceted roles in cellular processes (Xian et al., 2009; Gopal, 2020). All SDCs are expressed in MuSCs, and it has been shown that the activation of MuSCs occurs in an SDC-dependent manner in mice (Pisconti et al., 2012; Pisconti et al., 2016; De Micheli et al., 2020). This finding is also in accordance with studies in chickens addressing SDC4 (Velleman and Song, 2017). In the context of WB, a noteworthy aspect of SDCs lies in their regulatory mechanisms, involving the shedding of their ectodomains through various sheddases, including MMP2 and MMP9 (Manon-Jensen et al., 2013; Pejšková et al., 2023). We have recently identified the shedding of SDCs and increased SDC4 gene expression in vivo to be involved in WB pathogenesis (Pejšková et al., 2023).
The present study aimed to characterize metabolic changes and muscle fibers in WB-affected chickens compared with non-affected chickens. Furthermore, we investigated the proliferation and differentiation potential of MuSCs isolated from normal and WB-affected chickens and their connection with SDC4 and its shedding.
2 Materials and methods
2.1 Animal handling and sampling
A total of 60 samples of breast muscle (Pectoralis major) were acquired from male Ross 308 broiler chickens (Gallus Gallus) at 36 days post-hatching (Pejšková et al., 2023). These chickens were raised with ad libitum access to a pelleted wheat/maize diet from the 10th day of age, housed in pens of dimensions 2.4 × 0.95 m with wood shavings, exposed to a lighting regimen of 6 h of light and 18 h of darkness, and subjected to a gradually decreasing temperature from 28°C to 21°C. The sampling procedure involved initial palpation-based sorting, followed by classification using histological methods and near-infrared (NIR) spectroscopy in combination with RNA-seq analysis. In our previous investigation (Pejšková et al., 2023), the samples showed a clear separation between birds with pronounced signs of fibrosis and collagen infiltration (hereafter termed “affected”) those with fewer signs (hereafter termed “non-affected”).
Muscle tissue specimens were obtained post-mortem from the breed chickens at NMBU, Norway. Given their conformity to established regulatory norms in food production, obtaining approval from the Regional Ethics Committee (REC) or the Norwegian Centre for Research Data (NSD) was deemed unnecessary. In accordance with Norwegian legislation governing the experimental use of animals (FOR-2015-06-18-761 §2a), ethical clearance is not obligatory for sample collection from animals slaughtered or utilized in non-experimental agricultural and aquacultural activities. This exemption was corroborated through direct correspondence with the Norwegian food safety authority, Mattilsynet.
2.2 In vivo tissue sample preparation and in vitro satellite cell isolation
In vivo tissue samples were prepared as described previously by Pejšková et al., 2023. Samples for RT-qPCR, RNA-seq, and proteomics were collected immediately after slaughter, snap-frozen in liquid nitrogen, and stored at −80°C until further analysis. For the microscopy immunofluorescence analysis, pieces of approximately 8 mm × 8 mm × 2 mm were cut from the outer layer in the upper part of the pectoralis major for all the animals after slaughtering, fixed in IHC Zinc Fixative (#550523, BD Pharmingen, New Jersey, USA) for 24 h before dehydrating and paraffin embedding. All animals were first sorted by palpation and then classified by histology and NIR spectroscopy (Pejšková et al., 2023) (hereafter termed NA (non-affected) and A (affected)).
Chicken primary muscle satellite cells (hereafter termed MuSCs) were isolated from biopsies collected from breast muscle (pectoralis major) obtained from the chicken sample groups described above or from breast fillet samples with or without WB from Ross 308 of the same age collected at the industrial abattoir and classified as non-affected or affected by NIR and histology (Nortura AS, Hærland, Norway). Tissue samples (2–5 g) were kept in PBS with 0.5% penicillin/streptomycin (10,000 units/mL) and 0.5% Fungizone before being minced using a knife on Petri dishes, and the resulting minced pieces of meat were transferred to tubes containing 10 mL collagenase (#C2674, Sigma-Aldrich) solution, followed by a 1-h incubation at 37°C with agitation at 70 rpm in a water bath. After a brief centrifugation at 550 RCF for 10 s, the supernatant was filtered using a 100-μm strainer and transferred to a new tube containing 10% fetal bovine serum (FBS). The tissue was further digested using 0.05% trypsin/EDTA for 1 h/70 rpm in a 37°C water bath, followed by 10% FBS addition for enzyme inactivation. The cell suspension was centrifuged, and the supernatant was again filtered using the strainer. Cells from both pellets were pooled and re-suspended in 3 mL of cell growth medium (DMEM 1X (#41965-047, Thermo Fisher Scientific, MA, USA), 20% chicken serum, 2% chicken embryo extract (#ICNA092850145, MP Biomedicals, CA, United States), 2% Ultroser™ G serum substitute (#15950-017, Sartorius AG, Germany), 0.5% penicillin/streptomycin (10,000 units/mL), and 0.5% Fungizone) and plated on uncoated 25-cm2 flasks. For the removal of the fast-adhering fibroblast cells from the primary muscle cells, the cells were placed in uncoated cell flasks for 1 h at 37°C. The non-adhering MuSCs were then collected and further seeded in 25-cm2 flasks coated with 3 μL/cm2 entactin-collagen IV-laminin (ECL, 1 mg/mL, Millipore, Billerica, MA, USA). Cell culture media was changed every 48 h during the cell culture process. The isolated cells were proliferated, split into 75 cm2 or 175 cm2 coated culture flasks, and then stored in liquid nitrogen in a growth medium containing DMSO until further use. All experiments were performed at the 3rd, 4th, or 5th passage.
Following the isolation of primary chicken cell lines, the growth medium was transitioned from DMEM 1x supplemented with 20% chicken serum, 2% chicken embryo extract, 2% Ultroser™ G serum substitute, 0.5% penicillin/streptomycin (10,000 units/mL), and 0.5% Fungizone to DMEM 1x containing 10% FBS, 2% Ultroser™ G serum substitute, 0.5% penicillin/streptomycin (10,000 units/mL), and 0.5% Fungizone for experimental purposes. Cell counting was performed using the automated cell counter NucleoCounter® NC-202™ (ChemoMetec A/S, Lillerød, Denmark). The cells were seeded on ECL-coated 96-well plates with a concentration of 2000 cells/well for the proliferation assay and 25,000 cells/well for the differentiation assay. Using Incucyte SX3/SX1 (Sartorius AG, Germany), the cells were monitored for 7 days in the case of proliferation in the incubator at 37°C and 5% CO2. The differentiation experiment was induced by a complete medium without FBS serum and Ultroser G in 85%–100% confluence after 1 day of proliferation and monitored for another 2 days.
2.3 Inhibition and transfection of MuSCs
MuSCs from both affected and non-affected groups (n = 3 each) were seeded at a density of 2000 cells per well in 96-well plates or 48,000 cells per well in 6-well plates. For the inhibition experiments, cells at 50% confluence were treated with inhibitors targeting the MEK/ERK pathway (#PD0325901, N-[(2R)-2,3-dihydroxypropoxy]-3,4-difluoro-2-[(2-fluoro-4-iodophenyl) amino]-benzamide, STEMCELL Technologies) and p38 MAPK pathway (#SB202190, 4-[4-(4-fluorophenyl)-5-(4-pyridinyl)-1H-imidazol-2-yl]-phenol, STEMCELL Technologies). Each inhibitor was dissolved in DMSO and administered to the well to reach a concentration of 25 µM.
MuSCs were transfected with chicken SDC4 (in pCEP4, UniProt #P49416, custom-made by GenScript Corp.) at 50% confluence using the Lipofectamine 3000 Transfection Kit (#L3000-008, Thermo Fisher Scientific) following the manufacturer’s protocol. To assess transfection efficiency, pEGFP-N1 (GenScript Corp.) was used as a readout, with 2.5 μg of DNA used per well. MuSCs were transfected for 24 h before lysis or treatment with blocking peptides. Blocking peptide (BP) sequences, corresponding to the ectodomain of chicken SDC4 protein (custom-made by GenScript Corp.), with underlined overlapping sequences and different solvents are provided in Table 1. BPs were used at a concentration of 2.5 µM for 2 h during the treatment of proliferating MuSCs.
TABLE 1
| Name | Sequence | Solvent |
|---|---|---|
| BP1 | MPLPRAAFLLGLLLAAAAAESVRETETMDA | 3% NH3 |
| BP2 | ETETMDARWLDNVGSGDLPDDEDIGEFTPH | H2O |
| BP3 | FTPHLTSDEFDIDDTSGSGDYSDY | DMSO |
| BP4 | YSDYDDAIYLTTVDTPAISDNYIPGDTERK | H2O |
| BP5 | PGDTERKMEGEKKNTMLDNEIIPDKASPVE | H2O |
Custom-made blocking peptides and their solvents.
2.4 Reverse transcription-quantitative PCR and RNA sequencing
RT-qPCR: the total RNA for RT-qPCR was isolated from tissue lysate (n = 8 in each group) or proliferating MuSCs (n = 8 in each group) using the RNeasy Mini Kit (#74104, QIAGEN, Germany) according to the manufacturer’s instructions.
The total RNA from tissue was prepared from approximately 100 mg of tissue by homogenization in the RLT buffer containing 2 mM DTT using the Precellys Lysing Kit (#P000911-LYSKO-A.0, Bertin Technologies, France), 4 × 20 at 6000 rpm with 10 break between shakes, followed by a 10-min spin at 5000 g. Samples were incubated with Proteinase K (#19131, QIAGEN, Germany) according to the manufacturer’s instructions. cDNA was generated from 2 µg of total RNA using TaqMan Reverse Transcription Reagents (#N8080234, Thermo Fisher Scientific, MA, United States) in a 40 µL reaction volume with random hexamers according to the manufacturer’s protocol.
Proliferating MuSCs (n = 8 in each group) were seeded in a 6-well plate at 12,000 cells/well and allowed to proliferate for 3 days; after washing twice, 350 µL of the RLT buffer containing 2 mM DTT was added. cDNA was generated from 290 ng of total RNA using the LunaScript RT SuperMix Kit (#E3010L, New England Biolabs, MA, USA) in a 30 µL reaction volume with random hexamers according to the manufacturer’s protocol. RT-qPCR analysis was carried out using the Luna Universal probe RT-qPCR Master Mix (#M3004X, New England Biolabs, MA, USA) and QuantStudio 5 (Applied Biosystems, Foster City, CA, USA) PCR System. The amplification protocol was initiated at 95°C for 1 min by initial denaturation, followed 40 cycles of denaturation at 95°C for 15 s and then extension at 60°C for 30 s.
RT-qPCR analyses were performed with three technical replicates from each sample. The relative gene expression was calculated using the comparative 2−ΔCt (Schmittgen and Livak, 2008; Bustin et al., 2010) method for the tissue and cell culture experiments comparing non-affected vs. affected samples. Non-affected MuSCs transfected with SDC4 were additionally analyzed and compared to the control using the 2−ΔΔCt method. In short, the values are generated by subtracting reference gene EEF2 values for each sample to obtain ΔCt values, and for ΔΔCt values, the values were related to the average gene expression of the untransfected control (Lipofectamine, MuSCs) for each gene. The relative gene expression is then calculated using formula 2-ΔCt or 2−ΔΔCt in the case of non-affected MuSC transfection. All TaqMan® primers and probes are listed in Table 2.
TABLE 2
| Gene target | TaqMan®primer/probe assays |
|---|---|
| EEF2 | Gg03339740_m1 |
| Mki67 | Gg07186598_s1 |
| CDKN2A | Gg07157676_m1 |
| CDKN1A | Gg03814244_s1 |
| MYOG | Gg03363788_m1 |
| MYOD1 | Gg03363970_m1 |
| SDC1 | Gg07175697_s1 |
| SDC2 | Gg03345644_m1 |
| SDC3 | Gg03339851_m1 |
| SDC4 | Gg03370419_m1 |
| PAX7 | Gg03348488_m1 |
Gene target and TaqMan® primer/probe assays.
RNAseq: total RNA was extracted from muscle tissue samples stored at −80°C using the RNAdvance Tissue Kit (Beckman Coulter, IN, USA) following the manufacturer’s guidelines. A NanoDrop Spectrophotometer (Thermo Fisher Scientific, MA, United States) was utilized to assess RNA purity and concentration of all samples, while the integrity of nine randomly selected samples was evaluated using a 4150 TapeStation RNA Screen Tape (Agilent, CA, United States). Extracted RNA (1.5–4.5 µg) was subsequently dispatched to a commercial sequencing provider (Novogene, United Kingdom), where quality reassessment confirmed the lowest RNA Integrity Number (RIN) to be 9.1. Sequencing libraries were prepared using NEBNext Ultra Directional RNA Library Prep Kits (NEB, MA, United States) and subjected to PE150 sequencing on NovoSeq 6000 instruments with S4 flow cells (Illumina, CA, United States). Quality control of reads was performed using FastQC (Andrews, 2010), and raw reads underwent trimming with fastp (Chen et al., 2018) to eliminate adapter sequences. Gene expression levels were determined by quantifying transcript expression with Salmon (Patro et al., 2017) using the GRCg7b reference genome from NCBI, and the data were summarized at the gene level. DESeq2 (Love et al., 2014) facilitated the analysis of differentially expressed genes between affected and normal groups. The R package clusterProfiler (Yu et al., 2012; Wu et al., 2021) was employed to estimate Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway enrichment for upregulated and downregulated gene sets separately.
For RNAseq of MuSCs (n = 19), RNA was extracted using the RNeasy Mini Kit and sent to Novogene for library preparation and sequencing. At Novogene, messenger RNA was purified from total RNA using poly-T oligo-attached magnetic beads. After fragmentation, the first-strand cDNA was synthesized using random hexamer primers, followed by the second-strand cDNA synthesis. The library was ready after the end repair, A-tailing, adapter ligation, size selection, amplification, and purification. The library was quantified using Qubit and real-time PCR, and size distribution was detected using a bioanalyzer . The quantified libraries were pooled and sequenced on an Illumina NovoSeq 6000 instrument. Sequencing QC was performed using FastQC v0.12.1 (Andrews, 2023), Trim Galore v0.6.7 (Krueger et al., 2021), and Cutadapt v3.4 (Martin, 2011). Reads were mapped to the GRCg7b version of the Gallus reference genome using STAR v2.7.9a (Dobin et al., 2013). Alignments were converted to BAM format and sorted using SAMtools v1.17 (Li et al., 2009). Transcript expression was then quantified with Salmon v1.10.1 (Patro et al., 2017) and converted to gene-level counts with Tximport v1.12.0 (Soneson et al., 2015). Differential expression analysis comparing the affected and not affected groups was next performed using the nf-core differential abundance pipeline v1.4.0 (Cristina Tuñí i Domínguez et al., 2023), with read count normalization and statistical analysis performed using DESeq2 v1.34.0 (Love et al., 2014). Initial exploratory analysis showed that two samples from the “not affected” group were statistical outliers based on the median absolute deviation of their normalized read counts, and these samples were excluded from further analysis. This left nine remaining samples in the not affected group and 10 samples in the affected group. The results of the differential expression analysis were visualized using the Enhanced Volcano R package v1.20.0 (Blighe and Lun, 2018).
Gene Set Enrichment Analysis (GSEA) was performed with the ClusterProfiler R package v4.10.1 (Yu et al., 2012; Wu et al., 2021) using the FGSEA algorithm (Korotkevich et al., 2016). Log2 fold-change scores were used to rank genes, and the results were visualized using the enrichplot package v1.22.0 (Wu et al., 2021). Network analysis was performed to find genes with correlated expression levels with WGCNA v.1.72.5 (Langfelder and Horvath, 2008) using normalized and variance-stabilized read counts and a soft-thresholding power value of 10. The genes present in selected modules were then subject to functional overrepresentation analysis (ORA) using ClusterProfiler v4.10.1. For the ORA, the background gene list was defined as the set of genes used in the differential expression analysis that also possessed relevant functional annotations.
2.5 Western blotting
Proliferating MuSCs were seeded at a concentration of 30,000 cells per well in a 6-well plate and allowed to proliferate for 3 days; after washing twice with PBS, the cells were lysed with 100 µL of RIPA buffer containing a phosphatase inhibitor cocktail 2 (#P5726, Sigma-Aldrich, Merck) and AEBSF protease inhibitor (#78431, Thermo Scientific, United States) for 30 min on ice. Samples were centrifuged at 13.000× g for 30 min at 4°C. The supernatant, containing soluble proteins, was collected and stored at −80°C until analysis. The protein concentration was determined using the Micro BCA Protein Assay Kit (#PIER23235, Thermo Fisher Scientific, Waltham, MA, USA).
Samples were prepared by mixing with 4x sample buffer, consisting of 5 g sucrose (#16104, Sigma Merck, Darmstadt, Germany), 3.75 mL 20% SDS (L3771, Sigma Merck), 1.25 mL 0.5 M Tris-HCl (pH 6.8) (T5941, Sigma Merck), 310 mg DTT (D9779, Sigma Merck), 1 mL of 0.1% bromophenol blue (B5525, Sigma Merck), and 10 mL of MQ H2O and boiling for 5 min at 95°C. In addition, 10 μg/μL of proteins were loaded onto a 4%–15% Criterion TGX Precast Gel (#5671084, Bio-Rad, Hercules, CA, United States). Precision Plus Protein All Blue Standards (#1610373, Bio-Rad) and Precision Plus Protein Dual Color Standards (#1610374, Bio-Rad) were used as standard molecular weights. The gels were blotted onto PVDF Western blotting membranes (#03010040001, Sigma Merck) with extra thick blot filter paper, precut (#1703967, Bio-Rad), using the Trans-Blot Turbo system (Bio-Rad). After transfer to membranes, the membranes were rinsed in ddH2O, and the water was discarded. The membranes were then incubated in 10 mL of Revert 700 Total Protein Stain solution (cat# 926-11021, LI-COR, Lincoln, NE, United States) for 5 min with gentle shaking. The Total Protein Stain Solution was then decanted completely, and the membranes were rinsed two times for 30 s with 10 mL of wash solution (6.7% glacial acetic acid and 30% methanol in water). The membranes were imaged immediately in the 700 nm (IR700) channel with Azure 600 (Azure Biosystems, Redmond, WA, United States). After imaging, the membranes were washed for 15 min in 1x TBS-T to remove the turquoise color from the stain. The PVDF membranes were blocked in 1% casein (Western Blocking Reagent, #11921681001, Sigma Merck) and TBS-T for 60 min at room temperature (RT), followed by incubation with primary antibodies such as SDC1–4 (1:1,000, custom-made, GenScript, Piscataway, NN, United States), p38 (M138) (1:1,000, #ab31828, Abcam, United Kingdom), Phospho-p38 MAPK(Thr180/Tyr182) (1:1,000, #9211, Cell Signaling, MA, USA), p44/42 MAPK (Erk1/2) (1:1,000, #4695, Cell Signaling), or Phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) (1:1,000, #9101, Cell Signaling) overnight at 4°C. Membranes were washed three times for 10 min each in TBS-T before being incubated with horseradish-peroxidase-conjugated secondary antibodies (anti-mouse IgG, NA931V, or anti-rabbit, NA934V, both from Cytiva, Marlborough, MA, USA) diluted 1:3,000 in TBS-T, goat anti-rabbit IgG and goat anti-mouse IgG secondary antibodies, HRP-conjugated (1:5000, #31460, #31430, Invitrogen), followed by three additional times 10-min washes in TBS-T. Blots were developed using ECL Prime (#RPN2236, GE Healthcare, IL, United States) or SuperSignal West Pico PLUS Chemiluminescent Substrate (#34577, Thermo Fisher Scientific, MA, United States) for chemiluminescence signal detection. The chemiluminescence signals were detected using Azure 600 (CA, United States) or iBright™ CL1500 Imaging System (Invitrogen). The membranes were reprobed with reference protein anti-GAPDH (#sc-47724, Santa Cruz, CA, United States) after stripping using the Restore Western blot Stripping buffer for 5 min at RT (#21063, Thermo Fisher Scientific, MA, United States) and washed 3 × 15 min in TBS-T before blocking. Quantification of Western bands was conducted using ImageQuant 10.2.499 (Cytiva).
2.6 Label-free quantitative mass spectrometry-based proteomics
Twelve biological replicates of each group, affected and non-affected samples, were included in the analysis. Salt-soluble proteins were extracted from approximately 100 mg chicken breast fillet using 1,000 µL of extraction buffer [10 mM Tris, pH 7.6; 1 mM EDTA; 0.25 M sucrose]. Samples were homogenized twice for 20 s at 6,000 rpm speed with a 5s pause between the homogenization steps using Precellys®24 (Bertin Technologies) and centrifuged at 16000 g for 15 min. The protein concentration was determined using the RC DC™ Protein Assay (#5000121, Bio-Rad Laboratories, Inc, United States). A measure of 60 µg of proteins was reduced with 0.1 M DTT, alkylated with 55 mM 2-iodoacetamide, and digested with trypsin/Lys-C (#V5071, Promega, United States) at a 1:30 (w/w) enzyme-to-protein ratio on a Microcon-10 YM (Merck Millipore, United States) centrifugal filter unit at 37°C overnight. The peptide concentration was measured using the NanoDrop One at 205 nm, and 10 µg of peptides were purified and concentrated using a StageTip following the protocols (Rappsilber et al., 2007; Yu et al., 2014). Peptides were resolved with a loading buffer [2% (v/v) ACN; 0.05% (v/v) trifluoroacetic acid], and 1 µg of peptides was analyzed using a nano-UHPLC coupled with a Q Exactive Quadrupole-Orbitrap Mass Spectrometer (Thermo Fisher Scientific, United States) at the MS/Proteomics Core Facility at Campus Ås. Detailed liquid chromatography-tandem mass spectrometry (LC-MS/MS) settings can be found in Koga et al. (2019). Peptides from the 12 most intense peaks obtained during the 120-min elution were fragmented, and the mass-to-charge ratios of these fragmented ions were measured (MS/MS). Mass spectral data were processed using MaxQuant version 2.3.1.0 (Cox and Mann, 2008). The parameters for protein identification included trypsin/Lys-C specificity with reference to the proteome database for broiler chicken, Gallus gallus (Entry nr. UP000000539), downloaded from UniProt (43710 entries). Other parameters were maintained as defaults, and the label-free quantification (LFQ) algorithm was employed for protein quantification. LFQ intensity values from MaxQuant were imported into Perseus software version 2.0.6.0 (Tyanova et al., 2016) for statistical analysis and visualization of the data. Prior to analysis, proteins identified only by site, reverse sequence, and potential contaminant proteins were excluded. LFQ intensities were log2-transformed, and proteins possessing valid LFQ intensity values in more than 70% of biological replicates for at least one of the groups (non-affected and affected) were retained for further analyses. Welch’s T-tests, with a 95% confidence limit taking the false discovery rate (FDR) into account, were carried out for all identified proteins between non-affected and affected chicken groups. GO enrichment analyses were carried out for the significantly differentially expressed proteins with g:GOSt on the online g:Profiler platform (Kolberg et al., 2023) with the following data sources: GO terms biological processes (GO: BP), KEGG, and Human Phenotype Ontology (HPO). Gene names for the four proteins were unknown, and therefore, they were omitted from the GO enrichment analysis. Ensemble IDs with the most GO annotations were selected for three proteins (gene names: RBP4, TTR, and ACTG1). Moreover, missing values for LFQ intensities were imputed from a normal distribution (default setting of width 0.3 and downshift 1.8) in Perseus, and principal component analyses were carried out using MATLAB 2022b (The MathWorks, Inc, Natick, MA, USA).
2.7 Immunohistochemistry and immunofluorescence
The histology scoring of the samples used in this research was performed by staining with hematoxylin and eosin (H&E) according to standard procedures and previously described in Pejšková et al., 2023. To perform immunofluorescence analyses, tissue sections of affected and non-affected WB samples (N = 8–11 for each group) were deparaffinized, rehydrated with xylene, followed by gradually decreasing ethanol concentration (100%, 95%, 70%, and 50%) and ddH2O (Milli-Q), and then washed once with PBS pH 7.4 for 3 min. Sections were permeabilized at RT with 0.5% Triton X-100 (#X100, Sigma-Aldrich, Merck) in PBS (PBS-T) for 10 min and then washed twice in PBS-T pH 7.4 for 5 min each. For muscle morphometry, sections were incubated with DAPI (4′,6-diamidino-2-phenylindole dihydrochloride) (#D1306, 2 mg/mL, Invitrogen, MA, USA), wheat germ agglutinin, and Alexa Fluor™ 555 Conjugated (#W32464, 1:1000, Thermo Fisher Scientific, MA, United States), diluted in PBS for 10 min, and washed with PBS for 5 min. For immunostaining, antigen retrieval was performed with sodium citrate buffer (10 mM sodium citrate, 0.05% Tween 20, and pH 6.0), prepared fresh on the day of use. Sections were incubated in pre-warmed sodium citrate buffer at 65°C for 10 min using a water bath (Fisher Scientific, Isotemp®, GPD 10, MA, United States) and plastic Coplin jars. Next, the coplin jars containing the slides were allowed to cool down to RT on the bench for at least 20 min. Sections were then briefly rinsed with ddH2O, then washed three times with PBS for 5 min each, blocked in 5% BSA in PBS at RT for 1 h, and then incubated in AffiniPure Fab Fragment goat anti-mouse IgG (H + L) (#115-007-003, 1:100, Jackson ImmunoResearch, PA, USA) diluted in PBS at RT for 30 min. Sections were then incubated overnight at 4°C in a humidified chamber with anti-PAX7 mouse antibody (PAX7-b, AB 528428, 1:100, DSHB, IA, USA) and anti-PCNA rabbit antibody (CPTC-PCNA-3, AB 2888965, 1:25, DSHB, IA, USA) and diluted in 5% BSA in PBS. The following day, the sections were washed with 0.1% Triton-X-100 in PBS for 5 min and washed once with PBS for 5 min before incubation with Alexa Fluor™ 488 goat anti-mouse IgG1 (#A-21121, #A-10667, 1:400, Invitrogen, MA, United States) and Alexa Fluor™ 555 donkey anti-rabbit IgG (H + L) (#A-31572, 1:400, Invitrogen, MA, United States) or Alexa Fluor™ 555 donkey anti-mouse IgG (H + L) (#A-21426 1:400, Invitrogen, MA, United States) diluted in 5% BSA or 0.1% blocking buffer in PBS at RT for 1 h. Sections were then washed with 0.1% Triton-X-100 in PBS for 5 min before being stained with DAPI (4′,6-diamidino-2-phenylindole dihydrochloride) (#D1306, 2 μM, Invitrogen, MA, United States) or NucBlue Live Cell Stain Ready Probe (Hoechst 33342, Invitrogen, MA, United States) diluted in PBS for 10 min, then washed two more times in PBS for 5 min, before incubating with TrueBlack® Plus to quench autofluorescence (#23014, 1:40, Biotium, CA, United States) for 1 h, and washed again in PBS for 5 min. Finally, sections were mounted with VECTASHIELD® PLUS Antifade Mounting Medium (H-1900, Vector Laboratories, CA, United States) or fluorescent mounting medium (#S3023, DAKO, Denmark) and imaged on a fluorescence digital microscope (EVOS M5000, Invitrogen, MA, United States) or fluorescence microscope (ZEISS Axio Observer Z1 microscope, Jena, Germany). Quantification of Pax7+ and PCNA + cells was conducted manually. Quantification of myofiber morphological parameters (size and central nucleation) was conducted using software SMASH (Smith and Barton, 2014).
Proliferating MuSCs were seeded at 18,000–20,000 cells/well in 12-well plates and grown on coverslips (12 mm) for 3 days. MuSC for immunostaining of differentiation experiment (n = 5 in each group) were grown on 96-well plates with seeding 10,000 cells/well, and differentiation was induced after 24 h by medium without serum and allowed to differentiate for another 2 days. MuSCs were fixed with 4% PFA for 10 min and washed 3x with PBS-tween (PBS-T), followed by permeabilization with 0.1% Triton-X-100 for 10 min. Samples were blocked in 1x blocking buffer (#ab126587, Abcam, United Kingdom) in PBS-T for 30 min. Proliferation cells were stained with primary antibodies PAX7 (1:10, PAX7-b, AB 528428, 1:100, DSHB, IA, USA), SDC4 (1:1000, GenScript), or, in the case of differentiated MuSCs, desmin (#ab8592, 1:80, Abcam, United Kingdom) prepared in 0.1% blocking buffer (#ab126587, Abcam, United Kingdom) and incubated overnight at 4°C. The next day, cells were washed twice with PBS-T and incubated with goat anti-mouse IgG, IgM, and IgA (H + L) secondary antibodies conjugated with Alexa Fluor™ 488 (1:400, #A-10667, Invitrogen, MA, United States), Alexa Fluor™ 555 donkey anti-mouse IgG (H + L) (#A-21426, 1:400, Invitrogen, MA, United States), and goat anti-rabbit IgG (H + L) cross-adsorbed secondary antibody conjugated with Alexa Fluor™ 546 (1:400, #A-10667, Invitrogen, MA, USA) and NucBlue Live Cell stain ready probe (Hoechst 33342, Invitrogen, MA, United States) for 2 h at RT. The samples were washed with PBS-T before being transferred onto a microscope slide and mounted using the fluorescent mounting medium (#S3023, DAKO, Denmark) in the case of coverslip glass samples. The slides or wells were examined by fluorescence microscopy analysis (ZEISS Axio Observer Z1 microscope, Jena, Germany), and images were contrast-adjusted using ImageJ (NIH, MD, United States).
2.8 Statistical analysis and software
For quantification of Western blots, ImageQuant TL 10.2–499 (Cytiva, GE Healthcare Life Sciences, MA, US) was used, with the background method of rolling ball (radius 2). All quantifications of the bands generated from the Western blots were displayed as the mean ± SEM (standard error of mean, n = 4–5). The statistical analyses of RT-qPCR (n = 7–8) and Western blots (n = 4–5) were performed in Graph Pad Prism version 10.4.0 (GraphPad Software, La Jolla, CA, USA), using nested t-test with Welch correction for RT-qPCR and t-test with Welch correction for Western blots. Statistical significance was considered p-values <0.05, as indicated in each figure. Explorative multivariate analysis by principal component analysis (PCA) was performed on proteomics data, both with and without normalization, using MATLAB 2022b (The MathWorks, Inc, Natick, MA, USA). In addition, explorative univariate analysis was conducted using Welch’s t-test for all detected proteins.
3 Results
3.1 Characterization of metabolic changes and myogenesis in WB in vivo
3.1.1 WB myopathic birds show metabolic changes
Previous studies have linked the importance of energy metabolism to the onset of WB development. We, therefore, investigated the salt-soluble proteins (proteins involved in metabolism and cellular processes) of the pectoralis major muscle from affected (N = 12) and non-affected (N = 12) animals by label-free quantitative MS-based proteomic analysis.
In addition, 819 proteins were identified, and PCA analysis showed a clear separation between the two groups along principal component 1 according to the expression of proteins (Figure 1A). Welch’s t-test indicated that 414 proteins were differentially expressed between groups, with 23 proteins significantly downregulated and 391 proteins significantly upregulated in the affected samples (Figure 1B). GO enrichment analyses revealed changes in proteins related to metabolic changes. The five enriched GO terms with the lowest p-value for upregulated and downregulated proteins are highlighted in the Manhattan plots and listed in the table (Figures 1C, D, respectively). In upregulated terms such as glycolysis, abnormal muscle fiber-type distribution, and increased variability in muscle fiber diameter. On the other hand, downregulated terms highlighted oxidative phosphorylation, skeletal myopathy, or metabolic pathways. All significantly enriched GO terms from upregulated and downregulated proteins are shown in Supplementary Tables S1, S2, respectively.
FIGURE 1
3.1.2 Muscle fibers and myogenic markers are altered in WB myopathy
Further characterization of the skeletal muscle using WGA staining confirmed extensive fibrosis in WB-affected chickens and widespread central nucleation of myofibers (Figure 2A). Interestingly, the vast majority of fibers were centrally nucleated (̴80%), which did not differ between groups (Figures 2A, B), indicative of active degeneration/regeneration regardless of the extent of WB pathology. In affected individuals, the muscle fibers were generally smaller, as shown by a shift toward smaller minimum Feret diameters (20–40 µm). However, there was also an increase in very large fibers (90–100 µm) compared to non-affected individuals (Figure 2C).
FIGURE 2
Skeletal muscle regeneration relies on a population of locally resident MuSCs, which express the paired box transcription factor family member Paired box 7 (PAX7) (Olguín and Pisconti, 2012; Yin et al., 2013). Co-immunostaining with the proliferation marker proliferating cell nuclear antigen (PCNA) showed that, although the number of PAX7-positive satellite cells was higher in affected samples, the ratio of those that were actively proliferating (PAX7+PCNA+) was the same between affected and non-affected samples, suggesting a mild defect in MuSC proliferation in vivo (Figure 2D).
Consistently, RNA sequencing gene expression analysis of muscle tissue samples showed significant differences in several factors important for myogenesis in affected vs. non-affected chicken breast samples. MuSC markers Paired box3 (PAX3), PAX7, and myogenic factor 5 (MYF5), as well as the early myogenic differentiation marker myogenin (MYOG), were all upregulated in affected muscles compared with non-affected ones (Supplementary Figure S1A). Although not significant, we observed the same trend for PAX7 and MYOG using RT-qPCR (Supplementary Figures S1B–D).
3.2 Exploration of SC proliferation and differentiation
3.2.1 MuSC proliferation is impaired
The data described so far suggests that a defect in myogenesis may be associated with tissue degeneration in the pectoralis major of chickens affected by WB. To further investigate a potential cell-autonomous role for MuSCs in the pathogenesis of WB, we isolated primary MuSCs from the pectoralis major of affected and non-affected individuals and expanded them in culture using established isolation and culture conditions (Yoshioka et al., 2020). Upon observing cell proliferation (Figure 3A), it became evident that the cells sourced from WB-affected muscles demonstrated impaired proliferation. Most of these cells failed to achieve more than 50% confluency before the cessation of cell growth. Two key signaling pathways regulating cell proliferation are the ERK and p38 pathways (Zhang and Liu, 2002). When these signaling pathways were inhibited (Figures 3B, C), the response was similar in both non-affected and affected chickens, suggesting these pathways were not impaired. Interestingly, inhibiting the ERK pathway did not impact cell proliferation in MuSCs (Figure 3B), while inhibiting p38 dramatically stopped proliferation in non-affected MuSCs (Figure 3C). Protein expression of p38 and ERK1/2 and their phosphorylated forms showed no statistical difference between groups; however, phosphorylated ERK1/2 showed a tendency to be downregulated in affected chickens (Figure 3D). These observations suggest that although the p38 MAPK signaling pathway is important for cell proliferation in chickens, this signaling pathway does not appear to be fully impaired in WB-affected cells.
FIGURE 3
To gather further insights into the underlying molecular causes of the striking differences observed in MuSC proliferation in vitro between affected and non-affected animals, we carried out transcriptomic analysis using RNA extracted from proliferating MuSCs. Surprisingly, the number of differentially expressed genes was relatively small, with 232 upregulated and 278 downregulated genes (Figure 4A) in the affected versus non-affected samples. Consistently, PCA analysis showed partial overlap between groups (Figure 4B); however, GSEA identified several terms that were differentially expressed between affected and non-affected MuSCs. The most highly significant function, with a negative normalized enrichment score (NES), downregulated in affected versus non-affected MuSCs samples, was related to proliferation (E2F targets and G2/M checkpoint, Figure 4C), as well as terms related to myogenesis (muscle structure development, cell, myotube, and myotube differentiation) (Figure 4C). In contrast, functions related to metabolisms appeared both upregulated (e.g., regulation of autophagy and lysosome) and downregulated (glycolysis), albeit overall pointing toward an anabolic trend. Finally, among the most significant trends were also those related to a pro-inflammatory response, which were mostly upregulated (e.g., interferon-gamma response and IL-6 signaling) (Figure 4C).
FIGURE 4
Investigation of senescence signs and markers of WB-affected MuSCs showed that apart from CDKN1a (p21), neither the genes of the senescence-associated secretory program (Supplementary Figure S2A) nor other cell cycle arrest markers (Supplementary Figures S2C–E) were differentially expressed in cells from affected chickens compared with cells from non-affected chickens. On the other hand, downregulation of TP53 (Supplementary Figures S2B, C), LMNB2 (Supplementary Figure S2B), and Ki67 (Supplementary Figure S2F) was observed in affected proliferating MuSCs. Inspection of nuclei morphology revealed a decreased perimeter of nuclei and increased area and circularity of nuclei in the affected cells (Supplementary Figure S2G).
Finally, network analysis identified five gene modules that were differentially enriched in affected vs. non-affected MuSCs. These modules again mapped to functions related to muscle development (Figure 4D, module 14), metabolisms (Figure 4D, modules 4, 6, and 15), and cell adhesion (Figure 4D, module 21), further supporting the findings previously described in the pathogenesis of WB.
3.2.2 Myogenesis in WB MuSCs is reduced, but differentiation remains intact
Since the downregulation of myogenesis was the most striking transcriptomic signature displayed by MuSCs isolated from affected chickens compared with those from non-affected chickens, we carried out RT-qPCR-based validation of genes that play a key role in myogenesis. As already observed in RNAseq (Figure 5A), PAX3 and PAX7 showed a modest, although statistically significant, decrease in affected samples, while MYF5, MYOD, and MYOG showed a trend toward a greater decrease, which was validated by RT-qPCR MYOG and PAX7 by RT-qPCR (Figure 5B).
FIGURE 5
Since the gene expression data suggested a differentiation defect, we sought to test whether cells from WB-affected chickens were inherently differentiation-defective. The differentiation assay was performed by seeding the cells at high density and immediately inducing them to differentiate without prior expansion. Surprisingly, MuSCs from both affected and non-affected chickens were able to form myotubes, as visualized by desmin staining (Figure 5C).
3.2.3 Syndecan-4 decreases the proliferation rate, and its shedding increased during WB
We have previously shown that SDC4 is a crucial regulator of MuSC homeostasis and function (Pisconti et al., 2012; Rønning et al., 2015; Velleman and Song, 2017; Keller-Pinter et al., 2018). When analyzing the relative gene expression of SDC4 in isolated MuSCs, we observed a slight, although not statistically significant, downregulation in the affected cells compared to the non-affected ones (Figure 6A). We have previously developed specific antibodies targeting the cytoplasmic part of the chicken SDCs (Pejšková et al., 2023). Interestingly, the band representing the core protein (20 kDa) and the remaining 10–17 kDa fragments, left after shedding, differed greatly between the groups. We observed that the 17 kDa fragment increased in the affected cells, while the 10 kDa band decreased, indicating a different shedding pattern (Figure 6B, full-length immunoblot is shown in Supplementary Figure S3A). We could not detect a difference in the intracellular localization pattern of SDC4 when we co-stained cells with PAX7 (Figure 6C).
FIGURE 6
To further study the mechanism of SDC4 in vitro, we overexpressed SDC4 in non-affected chicken MuSCs (Figure 6D), which confirmed the involvement of SDC4 in cell proliferation since we observed a reduced cell growth of transfected cells compared to non-transfected controls (Figure 5E). However, this reduction was not linked to p38 MAPK or its phosphorylation (Supplementary Figure S4). Likewise, the overexpression of SDC4 influenced gene expression levels of PAX7, MYOD, and MYOG (Figure 6F).
Finally, we analyzed the gene expression levels of the other SDCs and observed that the gene expression of SDC1–3 was upregulated although not significantly for SDC1 and SDC3 (Supplementary Figure S3B). When we examined their protein levels, the SDC1–3 band pattern differed greatly between the groups, showing increased shedding in affected animals compared to non-affected ones (Supplementary Figure S3B), similar to what we observed for SDC4 (Figure 6B). Additionally, SDC4 overexpression in non-affected MuSCs led to increased gene expression of SDC1 and SDC2, whereas SDC3 remained unchanged, suggesting that SDC4 is able to modulate levels of other SDC family members in MuSCs (Supplementary Figure S3C).
3.3 Blocking peptides derived from SDC4 ectodomain reduced shedding
To investigate whether SDC4 shedding is involved in the regulation of MuSC proliferation in vitro, we developed five overlapping blocking peptides representing the extracellular part of chicken SDC4 (Figure 7A). When incubated with the MuSCs, the SDC4-derived blocking peptides (BP1-5) did not show any significant effect on proliferation, neither on non-affected nor affected cells (Figure 7B). However, when the peptides were incubated with non-affected MuSCs overexpressing SDC4, an increase in the growth rate was observed, particularly in the presence of BP3 or the combination of BP4+5 (Figure 7C). Furthermore, immunoblot analysis showed that at least BP5 appeared to reduce SDC4 shedding (Figure 7D). Notably, SDC4 overexpression could not be achieved in affected MuSCs due to their low proliferation rate.
FIGURE 7
4 Discussion
4.1 Skeletal muscle regeneration in WB chickens in vivo
This study aimed to investigate the underlying causes of the pathological changes in skeletal muscle in chickens with WB, specifically focusing on the role of SDC function. We have previously identified altered SDC expression and function associated with the extensive ECM remodeling in chicken WB myopathy (Pejšková et al., 2023). The chicken breed Ross 308 investigated in this study developed WB myopathy at relatively high rates and showed signs of degenerative pathologies, such as central nucleation, regardless of the disease severity. Interestingly, even the group classified as ‘non-affected’ in our study, despite lacking extensive fibrosis, includes birds whose breast muscle shows centrally nucleated myofibers and, occasionally, necrotic myofibers and regions of inflammation. There were no differences in the number of centrally nucleated fibers between affected and non-affected WB birds. Although the percentage of centrally nucleated fibers in our study was similar between groups, other studies have shown that these fibers, defined by nuclei positioned at the center of the cytoplasm, are markers of muscle regeneration (Gutpell et al., 2015). They are commonly observed in patients with muscular dystrophies and their animal models (Folker and Baylies, 2013; Sihvo et al., 2014; Roman and Gomes, 2018), suggesting a potential genetic predisposition to myopathy in all Ross 308 chickens.
A hallmark of several muscular disorders, including wooden breast myopathy, is myofiber size heterogeneity, often resulting from continuous cycles of degeneration/regeneration (Soglia et al., 2016). Our histological analysis revealed a significant increase in small and large muscle fibers in affected chickens compared to medium muscle fiber sizes of non-affected chickens. This observation is partially consistent with previous research, showing an increase in small myofibers in WB (Meloche et al., 2018). Von Maltzahn et al. (2013) demonstrated that muscles of Pax7−/− mice showed myofibers with approximately 50% fewer nuclei and significantly smaller fiber diameters. However, in our case, we observed increased PAX7 gene expression, as well as a higher number of total PAX7 expressing satellite cells per 100 fibers. Additionally, PAX3, MYF5, MYOG, and MYH1B were upregulated, indicating an expansion of the MuSC pool and maintained differentiation potential. This contrasts with previous findings by Daughtry et al. (2017), who showed that greater muscle hypertrophy correlates with a decrease in MuSCs and their impaired function.
Fibrosis and metabolic alterations are deeply interconnected with the progression and severity of muscle disorders (Lake and Abasht, 2020; Lake et al., 2022; Chen et al., 2023). Our proteomic data highlighted metabolic changes in affected samples linked to muscle abnormalities and significant disruptions in glycolysis, lipid, and amino acid metabolism. Mitochondrial processes play a crucial role in maintaining cellular homeostasis and skeletal muscle health, and their dysfunction is a key feature of muscle disorders such as muscular dystrophy, sarcopenia, and cachexia—all marked by muscle mass loss, reduced fiber size, decreased strength, and fibrosis (Hasegawa et al., 2021). We observed downregulation of proteins related to respiration and mitochondrial function, and GO terms of interest included proteins related to muscle fiber type, distribution, diameter variability, oxidative phosphorylation, and skeletal myopathies, suggesting mitochondrial dysfunction and oxidative stress involved in our affected chickens (Supplementary Table S2) and aligning with previous metabolomic analysis in WB chickens (Wang et al., 2023). Similar findings have been highlighted in other proteomics studies on white striping myopathy (Kong et al., 2024) and oxidative stress (Carvalho et al., 2023).
4.2 Involvement of syndecan-4 in impaired MuSC proliferation
Muscle regeneration involves several stages: necrosis of the injured muscle cells, activation and proliferation of muscle stem cells, differentiation into muscle fibers, remodeling of the muscle tissue, and, finally, maturation of the regenerated fibers. To examine the regenerative capabilities of primary chicken MuSCs, MuSCs were extracted from both affected and non-affected chicken pectoral muscles, and their proliferation was assessed in real time. Primary MuSCs from WB-affected chickens exhibited impaired proliferation but were still able to differentiate and form myotubes, in contrast to previous reports of reduced proliferation accompanied by a loss of differentiation capability (Daughtry et al., 2017; Xu and Velleman, 2023). RNA-seq analysis of the MuSCs identified several functions associated with impaired proliferation (E2F targets and G2/M checkpoint) and DNA replication, supporting our findings of decreased proliferation in vitro. Moreover, we also observed the downregulation of development and differentiation markers, such as PAX7, PAX3, MYF5, and MYOG. The seemingly conflicting results between our RNA-seq data, which suggest a differentiation defect, and the differentiation assay results, which show that MuSCs from affected animals retain their differentiation potential in vitro, can be explained by the fact that delayed proliferation may lead to delayed initiation of the differentiation program due to the community effect (Arnold et al., 2020).
Cellular senescence in skeletal muscle serves multiple functions, and it has been proposed that senescence in MuSCs delays muscle regeneration (Saito and Chikenji, 2021). Furthermore, signs of senescence have been observed in other myopathies in chickens (Wright, 1985; Malila et al., 2020). To investigate whether the impaired proliferation in chicken MuSCs was due to senescence, we examined multiple senescence markers. Senescent cells exhibit characteristic morphological and biochemical changes, including hypertrophy, flattened morphology, incomplete nuclear envelope, and increased activity of biomarkers such as CDKN2A, CDKN1A, Ki67, γH2AX, and SA-β-gal, markers of the senescence-associated secretory phenotype (SASP), such as IL6 and LAMB1, several insulin-like growth factor binding proteins, and MMPs and their inhibitors such asTIMP (Gorgoulis et al., 2019; Hansel et al., 2020; Saito and Chikenji, 2021). Our data showed only partial morphological changes in the proliferating MuSCs, along with an increase in CDKN1A mRNA, without any alterations in SASP gene expression. This suggests that the impairment in MuSC proliferation is unlikely to be solely caused by senescence.
Subsequently, we explored whether an impaired response to mitogenic signals might contribute to the reduced proliferation of primary MuSCs from WB-affected chickens. It has been earlier postulated that a possible mechanism for senescence-induced impairment of muscle regeneration is the premature senescence triggered by sustained p38 MAPK activity, leading to stem cell exhaustion (Bernet et al., 2014; Cosgrove et al., 2014; Blau et al., 2015; Saito and Chikenji, 2021), although the involvement of signaling pathways in WB myopathy remains not fully explained. To test this hypothesis, we inhibited the P38 MAPK and MEK/ERK signaling pathways, which are recognized as crucial regulators of cell proliferation, differentiation, and survival (Jones et al., 2001; Jones et al., 2005; Perdiguero et al., 2007). While the inhibition of ERK did not affect the proliferation rate in either of the samples, the inhibition of p38 led to a decrease in proliferation in both affected and non-affected cells, suggesting that neither ERK nor p38 is likely involved in the mechanisms that lead to WB-associated defect in MuSC proliferation. Observation of their protein expression and phosphorylation during WB myopathy showed that p38 remains without changes between affected and non-affected group, and ERK1/2 showed a tendency to decrease phosphorylation in WB-affected MuSCs. However, in our earlier in vivo investigation of WB myopathy, we observed the upregulation of the ERK1/2 MAPK signaling pathway (Pejšková et al., 2023), which supports the involvement of the ERK pathway in WB, although not necessarily through its role in myogenesis.
In mammals, all four SDCs are expressed during muscle development (Cornelison et al., 2001; Olguin and Brandan, 2001; Do et al., 2015) and contribute to the regulation of myogenesis and MuSC activity, as supported by multiple studies (Cornelison et al., 2001; Cornelison et al., 2004; Velleman et al., 2004; Pisconti et al., 2012; Rønning et al., 2015; Pisconti et al., 2016). Our RNA-seq from MuSCs isolated from WB-affected chickens revealed the downregulation of several gene terms associated with ECM-receptor interactions, focal adhesion, and GAG heparan biosynthesis, pointing toward the involvement of SDCs. Interestingly, the loss of MAPK signaling in SDC4 knockout mice prevented MuSC activation and proliferation (Jones et al., 2001; Jones et al., 2005; Perdiguero et al., 2007; Karimian et al., 2016), showing SDC4 to be required for satellite cell activation. On the other hand, other studies have shown that silencing or knockdown of SDC4 resulted in decreased progression of cell cycle (Keller-Pinter et al., 2018) and decreased proliferation (Yan et al., 2014; Velleman et al., 2018; Pham et al., 2023). Interestingly, SDC1 expression is shown to be downregulating SDC4 via ERK1/2 and p38 (Hara et al., 2021). Due to the decreased tendency of the mRNA level of SDC4 in WB-affected MuSCs and their reduced proliferation rate, we tested whether overexpression of SDC4 would impact proliferation or alter myogenesis. Our results demonstrated a reduction in MYOD and MYOG gene expression following SDC4 overexpression in NA MuSCs, mirroring the findings observed in the cells isolated from chickens with WB. This suggests that SDC4 overexpression may mimic the impaired myogenesis observed in WB. In contrast, the overexpression of SDC4 led to an increase in PAX7 mRNA and a reduction in MuSC proliferation, suggesting a role for SDC4 in promoting MuSC self-renewal at the expense of myogenesis. Consistent with our findings, the overexpression of SDC4 in turkey satellite cells has been shown to reduce proliferation after 72 h, and it has been proposed that increased SDC4 expression may lead to the formation of more focal adhesions, thereby reducing cell migration (Song et al., 2011).
4.3 Shedding of the SDC4 ectodomain contributes to wooden breast
Although we did not observe any significant changes in the relative gene expression of SDC4 in proliferating MuSCs, we detected alterations in protein expression, specifically the various SDC4 fragments that remained after shedding. This was also the case for the other SDCs, highlighting the complexity and significance of these molecules in WB myopathy in vitro. These findings complement our earlier in vivo study, indicating that all SDCs are present during WB and exhibit significant shedding (Pejšková et al., 2023). Although SDC1 has been extensively studied for its shedding and use as a biomarker for several diseases (Bertrand and Bollmann, 2019; Rangarajan et al., 2020), shedding of SDC4 has been previously shown as an important regulator in pathologies such as cardiac dysfunctions (Strand et al., 2013; Strand et al., 2023), diabetes mellitus (Li et al., 2016), osteoarthritis (Bollmann et al., 2021), and cancer (Choi et al., 2010).
The SDC4 ectodomain is critical in interactions with the extracellular matrix, growth factors, and cytokines (Tkachenko et al., 2005). Shedding of this ectodomain affects cell behavior, such as cell migration during tissue repair (Manon-Jensen et al., 2010), although the complete impact of this process is not yet fully understood. We tried to elucidate the function of SDC4 ectodomain shedding by adding custom-made blocking peptides to proliferating non-affected and WB-affected MuSCs, representing specific areas of the SDC4 ectodomain. We could not observe any change in cell proliferation when adding the peptides. However, when adding the BPs to SDC4-transfected MuSCs, we were able to restore some of the proliferation capability, especially using the blocking peptide BP3. BP3 consists of the chicken protein sequence FTPHLTSDEFDIDDTSGSGDYSDY. Interestingly, this sequence corresponds to the SDC4 ectodomain, containing two consecutive Ser-Gly (SG) sites reported to be GAG chain regions (Kokenyesi and Bernfield, 1994). Compared to SDC1 and SDC3, SDC4 exhibits only heparan sulfate GAG chains. Heparan sulfates on proteoglycans regulate growth factor signaling by acting as co-receptors, reservoirs, or transporters; therefore, adding BP hindering shedding activity might alter the biological function of syndecan directly or indirectly (Keller-Pinter et al., 2018). It has been shown that several growth factors bind to the SDC4 heparan sulfates, which then act as co-receptors for tyrosine kinase activity (Sarrazin et al., 2011). However, it is important to point out that our BP3 is most likely not able to bind to ligands that are dependent on heparan sulfates/GAGs as BP3 only is a short protein sequence with identical amino acids to a smaller stretch of the SDC4 ectodomain. It is possible that BP3 is competing with other ligands containing similar protein sequences, preventing the cells from undergoing differentiation, which might explain our increase in cell proliferation. Still, we cannot rule out the possibility of peptide uptake into the cell, with GAG chains of other molecules potentially playing a role in this process (Favretto et al., 2014), or effect on other cellular functions, such as signaling pathways, adhesion dynamics, or differentiation. Interestingly, shedding of the core SDC4 protein was significantly reduced by BP5 or a combination of BP4 and BP5, which indicates that at least BP5 contains an MMP-binding (cleavage) site, allowing it to outcompete MMP binding to the SDC4 ectodomain, thereby inhibit shedding of SDC4. This observation corresponds with previously detected cleavage by MMP2 and MMP9 in the human SDC4 ectodomain in lysine 105 (Manon-Jensen et al., 2013) situated in our BP5 region. However, current knowledge about the specific cleavage sites on the chicken SDC4 core protein remains limited. Our findings offer new insights into the cleavage and shedding of SDC4 in chickens. Considering the pivotal role of SDC4 in cellular regulation and disease, additional research is essential to unravel the mechanisms driving myogenesis.
5 Conclusion
This study aimed to elucidate the molecular basis of WB myopathy. Our research revealed significant molecular and cellular alterations associated with WB myopathy and indicated a role of SDC4 in its pathogenesis. We showed different shedding patterns of SDC4 in affected and non-affected primary MuSCs and observed reduced growth in non-affected MuSCs during SDC4 overexpression. Using specific blocking peptides, each representing a specific part of the chicken SDC4 ectodomain, we demonstrated increased proliferation and decreased shedding of SDC4 in MuSCs. The increased shedding identified across all members of the syndecan family suggests an involvement of SDCs in the pathogenesis of WB; further investigation into their regulatory mechanisms could provide valuable insights for the development of targeted therapeutic interventions.
Statements
Data availability statement
The proteomic data presented in the study are deposited in the UCSD/CCMS - MassIVE Datasets - Mass Spectrometry Repository Dataset List repository, accession number MSV000096414. The RNA seq data presented in the study are deposited in the GEO Accession viewer repository, accession number GSE279699.
Ethics statement
Ethical approval was not required for the study involving animals in accordance with the local legislation and institutional requirements because the muscle tissues used are extracted from already slaughtered chickens (Ross 308 breed, NMBU, Norway). These chickens are in line with common regulatory roles of food production and, therefore, do not require REC or NSD approval. In compliance with Norwegian law regulations concerning the experimental use of animals (FOR-2015-06-18- 761 §2a), ethical approval is not necessary when samples are collected from slaughtered animals/non-experimental agriculture and aquaculture. This is also confirmed by direct communication with the Norwegian Food Safety Authority (Mattilsynet).
Author contributions
LP: data curation, formal analysis, investigation, methodology, visualization, writing–original draft, and writing–review and editing. AP: data curation, formal analysis, methodology, and writing–review and editing. ML: data curation, formal analysis, methodology, and writing–review and editing. KH: data curation, formal analysis, methodology, and writing–review and editing. NS: data curation, formal analysis, methodology, and writing–review and editing. SK: data curation, formal analysis, methodology, and writing–review and editing. ET: writing–review and editing, data curation, and validation. CC: conceptualization, funding acquisition, project administration, supervision, and writing–review and editing. MP: conceptualization, funding acquisition, supervision, writing–review and editing, and project administration. SR: writing–review and editing, conceptualization, funding acquisition, methodology, and supervision.
Funding
The author(s) declare that financial support was received for the research, authorship, and/or publication of this article. Funding from the Norwegian Research Council (“ChickenHealth”, no.323939) is acknowledged. The authors also thank the Norwegian Fund for Research Fees for Agricultural Products (FFL) for additional support through the projects “SusHealth” (project number 314599) and “Precision” (project number 314111).
Acknowledgments
The authors would like to acknowledge Birger Svihus at the Norwegian University of Life Sciences for assistance in planning the chicken feeding trial and the Livestock Production Research Center for technical assistance. The authors would also like to thank Atle Løvland from Nortura for assistance in planning and sampling and Karen Sanden and Lene Øverby from Nofima for technical assistance during sampling. The authors would like to thank Jens-Petter Wold for NIR spectroscopy initial grading and Vibeke Høst for the histology and scoring of affected/non-affected chickens, as well as for technical assistance during the proteomics experiments, and Matthew Peter Kent and Thu-Hien To for contribution on in vivo RNAseq and scientific discussions. Finally, the author’s acknowledges David Carlson, Genomics Core Facility, Stony Brook University, who performed statistics on RNA sequencing dataset from MuSCs. ChatGPT (GPT-4 model) was used for polishing and improving the clarity, coherence, and overall readability of the scientific paper. The tool was used in a manner that does not conflict with APS ethical policies, and the authors take full responsibility for the content. The authors thank the Norwegian Fund for Research Fees for Agricultural Products (FFL) for supporting the study through the projects “SusHealth” (project number 314599) and “Precision” (project number 314111).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Generative AI statement
The author(s) declare that Generative AI was used in the creation of this manuscript. The author(s) verify and take full responsibility for the use of generative AI in the preparation of this manuscript. Generative AI, ChatGPT (GPT-4 model), was used to polish and improve the clarity, coherence, and overall readability of the scientific paper. The tool was used in a manner that does not conflict with APS ethical policies, and the authors take full responsibility for the content.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors, and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fphys.2024.1513311/full#supplementary-material
References
1
AfratisN. A.NikitovicD.MulthauptH. A.TheocharisA. D.CouchmanJ. R.KaramanosN. K. (2017). Syndecans–key regulators of cell signaling and biological functions. Febs J.284 (1), 27–41. 10.1111/febs.13940
2
AndrewsS. (2010). “FastQC: a quality control tool for high throughput sequence data,” in Babraham bioinformatics. Cambridge, United Kingdom: Babraham Institute.
3
AndrewsS. (2023). FastQC version 0.12.1. Babraham Bioinforma.Available at: https://www.bioinformatics.babraham.ac.uk/projects/fastqc/.
4
ArnoldL. L.CecchiniA.StarkD. A.IhnatJ.CraiggR. N.CarterA.et al (2020). EphA7 promotes myogenic differentiation via cell-cell contact. Elife9, e53689. 10.7554/eLife.53689
5
BernetJ. D.DolesJ. D.HallJ. K.Kelly TanakaK.CarterT. A.OlwinB. B. (2014). p38 MAPK signaling underlies a cell-autonomous loss of stem cell self-renewal in skeletal muscle of aged mice. Nat. Med.20 (3), 265–271. 10.1038/nm.3465
6
BertrandJ.BollmannM. (2019). Soluble syndecans: biomarkers for diseases and therapeutic options. Br. J. Pharmacol.176 (1), 67–81. 10.1111/bph.14397
7
BlauH. M.CosgroveB. D.HoA. T. V. (2015). The central role of muscle stem cells in regenerative failure with aging. Nat. Med.21 (8), 854–862. 10.1038/nm.3918
8
BligheK.LunA. (2018). PCAtools: everything principal components analysis. R. Package Version. Available at: https://github.com/kevinblighe.PCAtools.
9
BollmannM.PinnoK.EhnoldL. I.MärtensN.MärtsonA.PapT.et al (2021). MMP-9 mediated Syndecan-4 shedding correlates with osteoarthritis severity. Osteoarthr. Cartil.29 (2), 280–289. 10.1016/j.joca.2020.10.009
10
BordiniM.WangZ.SogliaF.PetracciM.SchmidtC. J.AbashtB. (2024). RNA-sequencing revisited data shed new light on wooden breast myopathy. Poult. Sci.103, 103902. 10.1016/j.psj.2024.103902
11
BustinS. A.BeaulieuJ.-F.HuggettJ.JaggiR.KibengeF. S. B.OlsvikP. A.et al (2010). MIQE précis: practical implementation of minimum standard guidelines for fluorescence-based quantitative real-time PCR experiments. BMC Mol. Biol.11 (1), 74. 10.1186/1471-2199-11-74
12
CarecciaG.MangiaviniL.CirilloF. (2024). Regulation of satellite cells functions during skeletal muscle regeneration: a critical step in physiological and pathological conditions. Int. J. Mol. Sci.25 (1), 512. 10.3390/ijms25010512
13
CarvalhoL. M.RochaT. C.DelgadoJ.Díaz-VelascoS.MadrugaM. S.EstévezM. (2023). Deciphering the underlying mechanisms of the oxidative perturbations and impaired meat quality in Wooden breast myopathy by label-free quantitative MS-based proteomics. Food Chem.423, 136314. 10.1016/j.foodchem.2023.136314
14
ChakkalakalJ. V.JonesK. M.BassonM. A.BrackA. S. (2012). The aged niche disrupts muscle stem cell quiescence. Nature490 (7420), 355–360. 10.1038/nature11438
15
ChenS.ZhouY.ChenY.GuJ. (2018). fastp: an ultra-fast all-in-one FASTQ preprocessor. Bioinformatics34 (17), i884–i890. 10.1093/bioinformatics/bty560
16
ChenW.ZhaoH.LiY. (2023). Mitochondrial dynamics in health and disease: mechanisms and potential targets. Signal Transduct. Target. Ther.8 (1), 333. 10.1038/s41392-023-01547-9
17
ChoiS.-J.LeeH.-W.ChoiJ.-R.OhE.-S. (2010). Shedding; towards a new paradigm of syndecan function in cancer. BMB Rep.43 (5), 305–310. 10.5483/bmbrep.2010.43.5.305
18
ChristovC.ChrétienF.Abou-KhalilR.BassezG.ValletG.AuthierF. J.et al (2007). Muscle satellite cells and endothelial cells: close neighbors and privileged partners. Mol. Biol. Cell18 (4), 1397–1409. 10.1091/mbc.e06-08-0693
19
CornelisonD. D.Wilcox-AdelmanS. A.GoetinckP. F.RauvalaH.RapraegerA. C.OlwinB. B. (2004). Essential and separable roles for Syndecan-3 and Syndecan-4 in skeletal muscle development and regeneration. Genes Dev.18 (18), 2231–2236. 10.1101/gad.1214204
20
CornelisonD. D. W.FillaM. S.StanleyH. M.RapraegerA. C.OlwinB. B. (2001). Syndecan-3 and syndecan-4 specifically mark skeletal muscle satellite cells and are implicated in satellite cell maintenance and muscle regeneration. Dev. Biol.239 (1), 79–94. 10.1006/dbio.2001.0416
21
CosgroveB. D.GilbertP. M.PorpigliaE.MourkiotiF.LeeS. P.CorbelS. Y.et al (2014). Rejuvenation of the muscle stem cell population restores strength to injured aged muscles. Nat. Med.20 (3), 255–264. 10.1038/nm.3464
22
CouchmanJ. R. (2010). Transmembrane signaling proteoglycans. Annu. Rev. Cell Dev. Biol.26, 89–114. 10.1146/annurev-cellbio-100109-104126
23
CoxJ.MannM. (2008). MaxQuant enables high peptide identification rates, individualized p.p.b.-range mass accuracies and proteome-wide protein quantification. Nat. Biotechnol.26 (12), 1367–1372. 10.1038/nbt.1511
24
DaughtryM. R.BerioE.ShenZ.SuessE. J. R.ShahN.GeigerA. E.et al (2017). Satellite cell-mediated breast muscle regeneration decreases with broiler size. Poult. Sci.96 (9), 3457–3464. 10.3382/ps/pex068
25
De MicheliA. J.LaurilliardE. J.HeinkeC. L.RavichandranH.FraczekP.Soueid-BaumgartenS.et al (2020). Single-cell analysis of the muscle stem cell hierarchy identifies heterotypic communication signals involved in skeletal muscle regeneration. Cell Rep.30 (10), 3583–3595.e5. 10.1016/j.celrep.2020.02.067
26
DoM. K. Q.ShimizuN.SuzukiT.OhtsuboH.MizunoyaW.NakamuraM.et al (2015). Transmembrane proteoglycans syndecan‐2, 4, receptor candidates for the impact of HGF and FGF 2 on semaphorin 3A expression in early‐differentiated myoblasts. Physiol. Rep.3 (9), e12553. 10.14814/phy2.12553
27
DobinA.DavisC. A.SchlesingerF.DrenkowJ.ZaleskiC.JhaS.et al (2013). STAR: ultrafast universal RNA-seq aligner. Bioinformatics29 (1), 15–21. 10.1093/bioinformatics/bts635
28
FavrettoM. E.WallbrecherR.SchmidtS.van de PutteR.BrockR. (2014). Glycosaminoglycans in the cellular uptake of drug delivery vectors – bystanders or active players?J. Control. Release180, 81–90. 10.1016/j.jconrel.2014.02.011
29
FolkerE.BayliesM. (2013). Nuclear positioning in muscle development and disease. Front. Physiology4, 363. 10.3389/fphys.2013.00363
30
GanassiM.MuntoniF.ZammitP. S. (2022). Defining and identifying satellite cell-opathies within muscular dystrophies and myopathies. Exp. cell Res.411 (1), 112906. 10.1016/j.yexcr.2021.112906
31
GopalS. (2020). Syndecans in inflammation at a glance. Front. Immunol.11, 227. 10.3389/fimmu.2020.00227
32
GorgoulisV.AdamsP. D.AlimontiA.BennettD. C.BischofO.BishopC.et al (2019). Cellular senescence: defining a path forward. Cell179 (4), 813–827. 10.1016/j.cell.2019.10.005
33
GutpellK. M.HrinivichW. T.HoffmanL. M. (2015). Skeletal muscle fibrosis in the mdx/utrn+/- mouse validates its suitability as a murine model of duchenne muscular dystrophy. PLOS ONE10 (1), e0117306. 10.1371/journal.pone.0117306
34
HanselC.JendrossekV.KleinD. (2020). Cellular senescence in the lung: the central role of senescent epithelial cells. Int. J. Mol. Sci.21 (9), 3279. [Online]. 10.3390/ijms21093279
35
HaraT.SatoA.YamamotoC.KajiT. (2021). Syndecan-1 downregulates syndecan-4 expression by suppressing the ERK1/2 and p38 MAPK signaling pathways in cultured vascular endothelial cells. Biochem. Biophys. Rep.26, 101001. 10.1016/j.bbrep.2021.101001
36
HasegawaY.KawasakiT.MaedaN.YamadaM.TakahashiN.WatanabeT.et al (2021). Accumulation of lipofuscin in broiler chicken with wooden breast. Anim. Sci. J.92 (1), e13517. 10.1111/asj.13517
37
HosotaniM.KawasakiT.HasegawaY.WakasaY.HoshinoM.TakahashiN.et al (2020). Physiological and pathological mitochondrial clearance is related to pectoralis major muscle pathogenesis in broilers with wooden breast syndrome. Front. Physiol.11, 579. 10.3389/fphys.2020.00579
38
JonesF. K.PhillipsA. M.JonesA. R.PiscontiA. (2022). The INSR/AKT/mTOR pathway regulates the pace of myogenesis in a syndecan-3-dependent manner. Matrix Biol.113, 61–82. 10.1016/j.matbio.2022.09.004
39
JonesN. C.FedorovY. V.RosenthalR. S.OlwinB. B. (2001). ERK1/2 is required for myoblast proliferation but is dispensable for muscle gene expression and cell fusion. J. Cell Physiol.186 (1), 104–115. 10.1002/1097-4652(200101)186:1<104::Aid-jcp1015>3.0.Co;2-0
40
JonesN. C.TynerK. J.NibargerL.StanleyH. M.CornelisonD. D.FedorovY. V.et al (2005). The p38alpha/beta MAPK functions as a molecular switch to activate the quiescent satellite cell. J. Cell Biol.169 (1), 105–116. 10.1083/jcb.200408066
41
KarimianA.AhmadiY.YousefiB. (2016). Multiple functions of p21 in cell cycle, apoptosis and transcriptional regulation after DNA damage. DNA Repair42, 63–71. 10.1016/j.dnarep.2016.04.008
42
Keller-PinterA.SzaboK.KocsisT.DeakF.OcsovszkiI.ZvaraA.et al (2018). Syndecan-4 influences mammalian myoblast proliferation by modulating myostatin signalling and G1/S transition. FEBS Lett.592 (18), 3139–3151. 10.1002/1873-3468.13227
43
KogaS.RiederA.BallanceS.UhlenA. K.Veiseth-KentE. (2019). Gluten-degrading proteases in wheat infected by Fusarium graminearum—protease identification and effects on gluten and dough properties. J. Agric. Food Chem.67 (40), 11025–11034. 10.1021/acs.jafc.9b03869
44
KokenyesiR.BernfieldM. (1994). Core protein structure and sequence determine the site and presence of heparan sulfate and chondroitin sulfate on syndecan-1. J. Biol. Chem.269 (16), 12304–12309. 10.1016/S0021-9258(17)32716-3
45
KolbergL.RaudvereU.KuzminI.AdlerP.ViloJ.PetersonH. (2023). g:Profiler—interoperable web service for functional enrichment analysis and gene identifier mapping (2023 update). Nucleic Acids Res.51 (W1), W207–W212. 10.1093/nar/gkad347
46
KongB.OwensC.BottjeW.ShakeriM.ChoiJ.ZhuangH.et al (2024). Proteomic analyses on chicken breast meat with white striping myopathy. Poult. Sci.103 (6), 103682. 10.1016/j.psj.2024.103682
47
KorotkevichG.SukhovV.BudinN.ShpakB.ArtyomovM. N.SergushichevA. (2016). Fast gene set enrichment analysis. biorxiv, 060012. 10.1101/060012
48
KruegerF.JamesF.EwelsP.AfyounianE.Schuster-BoecklerB. (2021). FelixKrueger/TrimGalore: v0.6.7 - DOI via zenodo. Zenodo. 10.5281/zenodo.5127899
49
LakeJ. A.AbashtB. (2020). Glucolipotoxicity: a proposed etiology for wooden breast and related myopathies in commercial broiler chickens. Front. Physiology11, 169. 10.3389/fphys.2020.00169
50
LakeJ. A.YanY.DekkersJ. C. M.QiuJ.BrannickE. M.AbashtB. (2022). Identification of circulating metabolites associated with wooden breast and white striping. PLoS One17 (9), e0274208. 10.1371/journal.pone.0274208
51
LangfelderP.HorvathS. (2008). WGCNA: an R package for weighted correlation network analysis. BMC Bioinforma.9, 559. 10.1186/1471-2105-9-559
52
LiH.HandsakerB.WysokerA.FennellT.RuanJ.HomerN.et al (2009). The sequence alignment/map format and SAMtools. Bioinformatics25 (16), 2078–2079. 10.1093/bioinformatics/btp352
53
LiR.XieJ.WuH.LiG.ChenJ.ChenQ.et al (2016). Syndecan-4 shedding impairs macrovascular angiogenesis in diabetes mellitus. Biochem. Biophysical Res. Commun.474 (1), 15–21. 10.1016/j.bbrc.2016.03.112
54
LoveM. I.HuberW.AndersS. (2014). Moderated estimation of fold change and dispersion for RNA-seq data with DESeq2. Genome Biol.15 (12), 550. 10.1186/s13059-014-0550-8
55
MalilaY.UengwetwanitT.ArayamethakornS.SrimarutY.ThanatsangK. V.SogliaF.et al (2020). Transcriptional profiles of skeletal muscle associated with increasing severity of white striping in commercial broilers. Front. Physiology11, 580. 10.3389/fphys.2020.00580
56
Manon-JensenT.ItohY.CouchmanJ. R. (2010). Proteoglycans in health and disease: the multiple roles of syndecan shedding. FEBS J.277 (19), 3876–3889. 10.1111/j.1742-4658.2010.07798.x
57
Manon-JensenT.MulthauptH. A. B.CouchmanJ. R. (2013). Mapping of matrix metalloproteinase cleavage sites on syndecan-1 and syndecan-4 ectodomains. FEBS J.280 (10), 2320–2331. 10.1111/febs.12174
58
MartinM. (2011). Cutadapt removes adapter sequences from high-throughput sequencing reads. EMBnet. J.17 (1), 10–12. 10.14806/ej.17.1.200
59
MashinchianO.PiscontiA.Le MoalE.BentzingerC. F. (2018). The muscle stem cell niche in health and disease. Curr. Top. Dev. Biol.126, 23–65. 10.1016/bs.ctdb.2017.08.003
60
MelocheK. J.DozierW. A.BrandebourgT. D.StarkeyJ. D. (2018). Skeletal muscle growth characteristics and myogenic stem cell activity in broiler chickens affected by wooden breast. Poult. Sci.97 (12), 4401–4414. 10.3382/ps/pey287
61
MotohashiN.AsakuraA. (2014). Muscle satellite cell heterogeneity and self-renewal. Front. Cell Dev. Biol.2, 1. 10.3389/fcell.2014.00001
62
MudalalS.LorenziM.SogliaF.CavaniC.PetracciM. (2015). Implications of white striping and wooden breast abnormalities on quality traits of raw and marinated chicken meat. Animal9 (4), 728–734. 10.1017/S175173111400295X
63
MutrynM. F.BrannickE. M.FuW.LeeW. R.AbashtB. (2015). Characterization of a novel chicken muscle disorder through differential gene expression and pathway analysis using RNA-sequencing. BMC Genomics16 (1), 399. 10.1186/s12864-015-1623-0
64
OlguinH.BrandanE. (2001). Expression and localization of proteoglycans during limb myogenic activation. Dev. Dyn. official Publ. Am. Assoc. Anatomists221 (1), 106–115. 10.1002/dvdy.1129
65
OlguínH. C.PiscontiA. (2012). Marking the tempo for myogenesis: Pax7 and the regulation of muscle stem cell fate decisions. J. Cell Mol. Med.16 (5), 1013–1025. 10.1111/j.1582-4934.2011.01348.x
66
PapahM. B.BrannickE. M.SchmidtC. J.AbashtB. (2017). Evidence and role of phlebitis and lipid infiltration in the onset and pathogenesis of Wooden Breast Disease in modern broiler chickens. Avian Pathol.46 (6), 623–643. 10.1080/03079457.2017.1339346
67
PatroR.DuggalG.LoveM. I.IrizarryR. A.KingsfordC. (2017). Salmon provides fast and bias-aware quantification of transcript expression. Nat. Methods14 (4), 417–419. 10.1038/nmeth.4197
68
PejškováL.RønningS. B.KentM. P.SolbergN. T.HøstV.Thu-HienT.et al (2023). Characterization of wooden breast myopathy: a focus on syndecans and ECM remodeling. Front. Physiology14, 1301804. 10.3389/fphys.2023.1301804
69
PerdigueroE.Ruiz-BonillaV.SerranoA. L.Muñoz-CánovesP. (2007). Genetic deficiency of p38alpha reveals its critical role in myoblast cell cycle exit: the p38alpha-JNK connection. Cell Cycle6 (11), 1298–1303. 10.4161/cc.6.11.4315
70
PetracciM.CavaniC. (2012). Muscle growth and poultry meat quality issues. Nutrients4 (1), 1–12. 10.3390/nu4010001
71
PetracciM.MudalalS.SogliaF.CavaniC. (2015). Meat quality in fast-growing broiler chickens. World's Poult. Sci. J.71 (2), 363–374. 10.1017/S0043933915000367
72
PetracciM.SogliaF.MadrugaM.CarvalhoL.IdaE.EstevezM. (2019). Wooden-breast, white striping, and spaghetti meat: causes, consequences and consumer perception of emerging broiler meat abnormalities. Compr. Rev. Food Sci. Food Saf.18 (2), 565–583. 10.1111/1541-4337.12431
73
PhamS. H.VuorinenS. I.ArifK. M. T.GriffithsL. R.OkolicsanyiR. K.HauptL. M. (2023). Syndecan-4 regulates the HER2-positive breast cancer cell proliferation cells via CK19/AKT signalling. Biochimie207, 49–61. 10.1016/j.biochi.2022.11.010
74
PiscontiA.BanksG. B.BabaeijandaghiF.BettaN. D.RossiF. M.ChamberlainJ. S.et al (2016). Loss of niche-satellite cell interactions in syndecan-3 null mice alters muscle progenitor cell homeostasis improving muscle regeneration. Skelet. Muscle6, 34. 10.1186/s13395-016-0104-8
75
PiscontiA.BernetJ. D.OlwinB. B. (2012). Syndecans in skeletal muscle development, regeneration and homeostasis. Muscles, ligaments tendons J.2 (1), 1–9.
76
RangarajanS.RichterJ. R.RichterR. P.BandariS. K.TripathiK.VlodavskyI.et al (2020). Heparanase-enhanced shedding of syndecan-1 and its role in driving disease pathogenesis and progression. J. Histochem. and Cytochem.68 (12), 823–840. 10.1369/0022155420937087
77
RappsilberJ.MannM.IshihamaY. (2007). Protocol for micro-purification, enrichment, pre-fractionation and storage of peptides for proteomics using StageTips. Nat. Protoc.2 (8), 1896–1906. 10.1038/nprot.2007.261
78
RomanW.GomesE. R. (2018). Nuclear positioning in skeletal muscle. Seminars Cell and Dev. Biol.82, 51–56. 10.1016/j.semcdb.2017.11.005
79
RønningS. B.CarlsonC. R.AronsenJ. M.PiscontiA.HøstV.LundeM.et al (2020). Syndecan-4(-/-) mice have smaller muscle fibers, increased akt/mTOR/S6K1 and notch/HES-1 pathways, and alterations in extracellular matrix components. Front. Cell Dev. Biol.8, 730. 10.3389/fcell.2020.00730
80
RønningS. B.CarlsonC. R.StangE.KolsetS. O.HollungK.PedersenM. E. (2015). Syndecan-4 regulates muscle differentiation and is internalized from the plasma membrane during myogenesis. PloS one10 (6), e0129288. 10.1371/journal.pone.0129288
81
SaitoY.ChikenjiT. S. (2021). Diverse roles of cellular senescence in skeletal muscle inflammation, regeneration, and therapeutics. Front. Pharmacol.12, 739510. 10.3389/fphar.2021.739510
82
SandenK. W.BöckerU.OfstadR.PedersenM. E.HøstV.AfsethN. K.et al (2021). Characterization of collagen structure in normal, wooden breast and spaghetti meat chicken fillets by FTIR microspectroscopy and histology. Foods10 (3), 548. 10.3390/foods10030548
83
SarrazinS.LamannaW. C.EskoJ. D. (2011). Heparan sulfate proteoglycans. Cold Spring Harb. Perspect. Biol.3 (7), a004952. 10.1101/cshperspect.a004952
84
SchmittgenT. D.LivakK. J. (2008). Analyzing real-time PCR data by the comparative CT method. Nat. Protoc.3 (6), 1101–1108. 10.1038/nprot.2008.73
85
SihvoH. K.ImmonenK.PuolanneE. (2014). Myodegeneration with fibrosis and regeneration in the pectoralis major muscle of broilers. Vet. Pathol.51 (3), 619–623. 10.1177/0300985813497488
86
SmithL. R.BartonE. R. (2014). SMASH - semi-automatic muscle analysis using segmentation of histology: a MATLAB application. Skelet. Muscle4, 21. 10.1186/2044-5040-4-21
87
SogliaF.MudalalS.BabiniE.Di NunzioM.MazzoniM.SirriF.et al (2016). Histology, composition, and quality traits of chicken Pectoralis major muscle affected by wooden breast abnormality. Poult. Sci.95 (3), 651–659. 10.3382/ps/pev353
88
SonesonC.LoveM. I.RobinsonM. D. (2015). Differential analyses for RNA-seq: transcript-level estimates improve gene-level inferences. F1000Res4, 1521. 10.12688/f1000research.7563.2
89
SongY.McFarlandD. C.VellemanS. G. (2011). Role of syndecan-4 side chains in Turkey satellite cell growth and development. Dev. Growth Differ.53 (1), 97–109. 10.1111/j.1440-169X.2010.01230.x
90
StrandM. E.HerumK. M.RanaZ. A.SkrbicB.AskevoldE. T.DahlC. P.et al (2013). Innate immune signaling induces expression and shedding of the heparan sulfate proteoglycan syndecan‐4 in cardiac fibroblasts and myocytes, affecting inflammation in the pressure‐overloaded heart. FEBS J.280 (10), 2228–2247. 10.1111/febs.12161
91
StrandM. E.VanhaverbekeM.HenkensM. T. H. M.SikkingM. A.RypdalK. B.BraathenB.et al (2023). Inflammation and syndecan-4 shedding from cardiac cells in ischemic and non-ischemic heart disease. Biomedicines11 (4), 1066. [Online]. 10.3390/biomedicines11041066
92
SztretyeM.SinglárZ.GanbatN.Al-GaadiD.SzabóK.KöhlerZ. M.et al (2023). Unravelling the effects of syndecan-4 knockdown on skeletal muscle functions. Int. J. Mol. Sci.24 (8), 6933. 10.3390/ijms24086933
93
TidballJ. G. (2011). Mechanisms of muscle injury, repair, and regeneration. Compr. Physiol.1 (4), 2029–2062. 10.1002/cphy.c100092
94
TkachenkoE.RhodesJ. M.SimonsM. (2005). Syndecans: new kids on the signaling block. Circulation Res.96 (5), 488–500. 10.1161/01.RES.0000159708.71142.c8
95
TyanovaS.TemuT.SinitcynP.CarlsonA.HeinM. Y.GeigerT.et al (2016). The Perseus computational platform for comprehensive analysis of (prote)omics data. Nat. Methods13 (9), 731–740. 10.1038/nmeth.3901
96
VellemanS. G. (2015). Relationship of skeletal muscle development and growth to breast muscle myopathies: a review. Avian Dis.59 (4), 525–531. 10.1637/11223-063015-Review.1
97
VellemanS. G. (2023). Broiler breast muscle myopathies: association with satellite cells. Poult. Sci.102 (10), 102917. 10.1016/j.psj.2023.102917
98
VellemanS. G.ClarkD. L. (2015). Histopathologic and myogenic gene expression changes associated with wooden breast in broiler breast muscles. Avian Dis.59 (3), 410–418. 10.1637/11097-042015-Reg.1
99
VellemanS. G.ClarkD. L.TonnigesJ. R. (2018). The effect of syndecan-4 and glypican-1 knockdown on the proliferation and differentiation of Turkey satellite cells differing in age and growth rates. Comp. Biochem. Physiology Part A Mol. and Integr. Physiology223, 33–41. 10.1016/j.cbpa.2018.05.014
100
VellemanS. G.ClarkD. L.TonnigesJ. R. (2019). The effect of nutrient restriction on the proliferation and differentiation of Turkey pectoralis major satellite cells differing in age and growth rate. Poult. Sci.98 (4), 1893–1902. 10.3382/ps/pey509
101
VellemanS. G.LiuX.CoyC. S.McFarlandD. C. (2004). Effects of syndecan-1 and glypican on muscle cell proliferation and differentiation: implications for possible functions during myogenesis. Poult. Sci.83 (6), 1020–1027. 10.1093/ps/83.6.1020
102
VellemanS. G.SongY. (2017). Development and growth of the avian pectoralis major (breast) muscle: function of syndecan-4 and glypican-1 in adult myoblast proliferation and differentiation. Front. physiology8, 577. 10.3389/fphys.2017.00577
103
von MaltzahnJ.JonesA. E.ParksR. J.RudnickiM. A. (2013). Pax7 is critical for the normal function of satellite cells in adult skeletal muscle. Proc. Natl. Acad. Sci.110 (41), 16474–16479. 10.1073/pnas.1307680110
104
WackerO.ManningJ.ZoufirA.nf-core bot, AlexanderP.DomínguezC. T.et al (2023). nf-core/differentialabundance: v1.4.0 - 2023-11-27.
105
WangZ.BrannickE.AbashtB. (2023). Integrative transcriptomic and metabolomic analysis reveals alterations in energy metabolism and mitochondrial functionality in broiler chickens with wooden breast. Sci. Rep.13 (1), 4747. 10.1038/s41598-023-31429-7
106
WoldJ. P.Veiseth-KentE.HøstV.LøvlandA. (2017). Rapid on-line detection and grading of wooden breast myopathy in chicken fillets by near-infrared spectroscopy. PLOS ONE12 (3), e0173384. 10.1371/journal.pone.0173384
107
WrightW. E. (1985). Myoblast senescence in muscular dystrophy. Exp. Cell Res.157 (2), 343–354. 10.1016/0014-4827(85)90119-3
108
WuT.HuE.XuS.ChenM.GuoP.DaiZ.et al (2021). clusterProfiler 4.0: a universal enrichment tool for interpreting omics data. Innov. (Camb)2 (3), 100141. 10.1016/j.xinn.2021.100141
109
XianX.GopalS.CouchmanJ. R. (2009). Syndecans as receptors and organizers of the extracellular matrix. Cell Tissue Res.339 (1), 31–46. 10.1007/s00441-009-0829-3
110
XuJ.VellemanS. G. (2023). Effects of thermal stress and mechanistic target of rapamycin and wingless-type mouse mammary tumor virus integration site family pathways on the proliferation and differentiation of satellite cells derived from the breast muscle of different chicken lines. Poult. Sci.102 (5), 102608. 10.1016/j.psj.2023.102608
111
YanZ.ChenG.YangY.SunL.JiangZ.FengL.et al (2014). Expression and roles of syndecan-4 in dental epithelial cell differentiation. Int. J. Mol. Med.34, 1301–1308. 10.3892/ijmm.2014.1910
112
YinH.PriceF.RudnickiM. A. (2013). Satellite cells and the muscle stem cell niche. Physiol. Rev.93 (1), 23–67. 10.1152/physrev.00043.2011
113
YoshiokaK.KitajimaY.OkazakiN.ChibaK.YonekuraA.OnoY. (2020). A modified pre-plating method for high-yield and high-purity muscle stem cell isolation from human/mouse skeletal muscle tissues. Front. Cell Dev. Biol.8, 793. 10.3389/fcell.2020.00793
114
YoungJ. F.RasmussenM. K. (2020). Differentially expressed marker genes and glycogen levels in pectoralis major of Ross308 broilers with wooden breast syndrome indicates stress, inflammation and hypoxic conditions. Food Chem. (Oxf)1, 100001. 10.1016/j.fochms.2020.100001
115
YuG.WangL.-G.HanY.HeQ.-Y. (2012). clusterProfiler: an R Package for comparing biological themes among gene clusters. OMICS A J. Integr. Biol.16 (5), 284–287. 10.1089/omi.2011.0118
116
YuY.SmithM.PieperR. (2014). A spinnable and automatable StageTip for high throughput peptide desalting and proteomics. Protoc. Exch.10.1038/protex.2014.033
117
ZammitP. S.RelaixF.NagataY.RuizA. P.CollinsC. A.PartridgeT. A.et al (2006). Pax7 and myogenic progression in skeletal muscle satellite cells. J. Cell Sci.119 (Pt 9), 1824–1832. 10.1242/jcs.02908
118
ZhangW.LiuH. T. (2002). MAPK signal pathways in the regulation of cell proliferation in mammalian cells. Cell Res.12 (1), 9–18. 10.1038/sj.cr.7290105
119
ZuidhofM. J.SchneiderB. L.CarneyV. L.KorverD. R.RobinsonF. E. (2014). Growth, efficiency, and yield of commercial broilers from 1957, 1978, and 2005. Poult. Sci.93 (12), 2970–2982. 10.3382/ps.2014-04291
Summary
Keywords
wooden breast, syndecan-4, myopathy, syndecans, broiler chicken, skeletal muscle satellite cells
Citation
Pejšková L, Pisconti A, Lunde M, Ho KY, Solberg NT, Koga S, Tengstrand E, Carlson CR, Pedersen ME and Rønning SB (2024) Wooden breast myopathy is characterized by satellite cell dysfunction and syndecan-4 shedding. Front. Physiol. 15:1513311. doi: 10.3389/fphys.2024.1513311
Received
18 October 2024
Accepted
25 November 2024
Published
23 December 2024
Volume
15 - 2024
Edited by
Sandra G. Velleman, The Ohio State University, United States
Reviewed by
Guglielmo Sorci, University of Perugia, Italy
Colin Guy Scanes, University of Wisconsin–Milwaukee, United States
Updates
Copyright
© 2024 Pejšková, Pisconti, Lunde, Ho, Solberg, Koga, Tengstrand, Carlson, Pedersen and Rønning.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Lucie Pejšková, lucie.pejskova@nofima.no
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.