Abstract
Legionella pneumophila, the major causative agent of Legionnaires’ disease, is found in freshwater environments in close association with free-living amoebae and multispecies biofilms, leading to persistence, spread, biocide resistance, and elevated virulence of the bacterium. Indeed, legionellosis outbreaks are mainly due to the ability of this bacterium to colonize and persist in water facilities, despite harsh physical and chemical treatments. However, these treatments are not totally efficient and, after a lag period, L. pneumophila may be able to quickly re-colonize these systems. Several natural compounds (biosurfactants, antimicrobial peptides…) with anti-Legionella properties have recently been described in the literature, highlighting their specific activities against this pathogen. In this review, we first consider this hallmark of Legionella to resist killing, in regard to its biofilm or host-associated life style. Then, we focus more accurately on natural anti-Legionella molecules described so far, which could provide new eco-friendly and alternative ways to struggle against this important pathogen in plumbing.
Introduction
Legionella pneumophila is a Gram-negative opportunistic intracellular human pathogen that is responsible for severe pneumonia called Legionnaires’ disease (LD; ). The case fatality rate of LD associated with outbreaks is lower than that of sporadic cases, generally around 8–15%, but it can be higher, particularly for hospital-acquired infections, acquired immune-deficiency syndrome (AIDS) patients, transplant patients, and those undergoing aggressive chemotherapy (). Among 60 Legionella species1, L. pneumophila is the leading cause of LD and L. pneumophila serogroup 1 is associated with almost 85–90% of the cases worldwide (; ; ; ). Since the first outbreak of pneumonia in 1976 (; ), many LD outbreaks have been linked to various sources of contaminated water in hospitals, hotels, cruise ships, industrial facilities, and family residences (). Generally, the economic cost of waterborne diseases including LD is elevated with over $430 million per year in the United States considering only hospitalized patients (). Thus, L. pneumophila has a high epidemiological and economical significance, being considered as an opportunistic plumbing pathogen. The bacterium is currently on the United States Environmental Protection Agency (USEPA) candidate contaminant list 42. Transmission to humans occurs after inhalation of contaminated water droplets. L. pneumophila reaches the alveolar mucosa and, thanks to its ability to resist phagocytosis, multiplies inside macrophages (). These latter are considered as the primary target of L. pneumophila although various data indicate that L. pneumophila can also invade epithelial cells, in which it can replicate (; ). Its resistance mechanisms to phagocytosis have been thoroughly described and several key steps are highly studied, among which the delivery of effectors into the host cytosol through the Dot/Icm type IV secretion system and the formation of the Legionella containing vacuole, which is known as the intracellular replicative niche for the bacterium (; ; ).
Within freshwater environments, L. pneumophila bacteria are ubiquitous organisms, mostly found as parasites of various free-living protozoa such as amoebae, their natural hosts (). Free-living amoebae are not solely responsible for L. pneumophila spreading, but they are also considered as biological shields as they protect intracellular bacteria from adverse conditions or biocide treatments (). Thus, amoebae play a key role in the life cycle and pathogenesis of L. pneumophila, and its ability to infect human macrophages is thought to be a consequence of prior adaptation to intracellular growth within various primitive eukaryotic hosts such as protozoa (; ). Moreover, upon transfer from natural freshwater habitats into anthropogenic systems, generally at higher temperature than ambient, L. pneumophila colonizes existing multispecies biofilms (). Colonization of these naturally occurring biofilms by L. pneumophila can be influenced by several other microorganisms among which protozoa are arguably of particular importance, as they constitute an ecological niche for the pathogen to replicate and to persist (). Co-evolution with multiple species of protozoa has resulted in the development of mechanisms that allow L. pneumophila to occupy a very broad host range (). Biofilms and free-living amoebae are thus considered to serve as main environmental reservoirs for L. pneumophila and represent a potential source of drinking water contamination, resulting in a potential health risk for humans (; ). Thus, it is of primary importance to find new antibacterial agents to control L. pneumophila environmental spread.
This paper presents an overview of the literature regarding the discovery of potential anti-Legionella control agents and their mechanisms of action, if known. First, various elements that allow L. pneumophila to resist to biocides in its environment are reviewed. Then, the high sensitivity of this bacterium to a diversity of biomolecules that could become of interest in the control of environmental pathogens in water systems is discussed.
Persistence of L. pneumophila in Its Microenvironment
Resistance of L. pneumophila within Biofilms
Legionella pneumophila is ubiquitous in natural and anthropogenic water systems, in which it is able to survive for long periods within biofilms (). Biofilms are defined as complex microbial communities characterized by cells that are attached to a substrate or phase boundary and to each other, and embedded into a matrix of self-produced extracellular polymeric substances (). Biofilms provide shelter and nutrients, exhibit a remarkable resistance to many stress factors, thus representing an interesting ecological niche for Legionella persistence. L. pneumophila has also the ability to parasitize protozoa, which commonly graze on biofilm communities (, ). Due to the intracellular lifestyle of L. pneumophila within protozoa, it is difficult to tease out whether the resistance of L. pneumophila in environmental biofilms is due to the biofilm structure, its association with amoebae or both ().
In artificial water systems as in drinking water distribution, Legionella growth is detected almost exclusively in biofilms covering the interior of pipe walls, ventilation, and air-conditioning systems, for example (). In addition to Legionella, these biofilms can become transient or long-term habitats for hygienically relevant microorganisms among which fecal indicator bacteria (Escherichia coli), obligate bacterial pathogens of fecal origin (Campylobacter sp.), opportunistic bacteria of environmental origin (Pseudomonas aeruginosa, Mycobacterium sp., Aeromonas sp.), enteric viruses (adenoviruses, rotaviruses, noroviruses), and parasitic protozoa (Cryptosporidium parvum). These organisms can attach to preexisting biofilms, where they become integrated and survive for days to weeks or even longer, depending on the biology and ecology of the organism and the environmental conditions (; ; ).
In order to restrain L. pneumophila growth, various treatments are used (e.g., physical, thermal, and chemical) in water systems (). However, they are not fully efficient, and after a lag period, L. pneumophila may be able to quickly re-colonize the system (; ; ). Environmental L. pneumophila found in biofilms are extremely resilient to treatment with biocides (; ; ; ). When this bacterium is exposed to environmental stresses including biocides and/or found within biofilms, it can enter in a viable but non-culturable state (). The most common biocides used to control waterborne pathogens are generally chlorine derivatives (; ; ; ). While hyperchlorination of potable water has been shown appropriate for treatment and removal of planktonic cultures of L. pneumophila, it remains ineffective against sessile communities (; ). Exposure to chlorine at regular intervals has also been shown to facilitate a higher tolerance to disinfectant, thus promoting bacterial resistance (). Chlorine dioxide is probably more effective than chlorine because of its superior oxidative power and effect on biofilms (; ). Chloramine, a powerful chlorine derivative biocide, is a recommended commercial formulation for disinfecting cooling towers. Yet, it has been shown to not completely eradicate L. pneumophila from biofilms (). Recent inquiries into the microbial ecology of distribution systems have shown that pathogen resistance to chlorination is affected by microbial community diversity and interspecies relationships. Multispecies biofilms are generally more resistant to chloramine disinfection than single-species biofilms. One of the reasons may be the presence of nitrifying bacteria leading to depletion of chloramine disinfectant residuals ().
Resistance of L. pneumophila in Association with Its Eukaryotic Hosts
According to the recommendations of the World Health Organization, water disinfection with chlorine has to be performed using a concentration of chlorine between 0.2 and 0.5 mg/l. However, it appears that Legionella is recovered if the treatment is not continuous. The persistence of L. pneumophila is due, at least partly, to its intra-amoeba lifestyle (; ) since these protozoa act as biological shields, protecting bacteria from biocides (). Amoeba-grown L. pneumophila are thus more resistant than planktonic cells to chemical disinfectants, biocides (; ), and antibiotics (). It has been indeed reported that intracellular L. pneumophila are released from amoebae within vesicles containing several hundreds of resistant bacteria to biocides such as the isothiazolone-derivative minimum bactericidal concentration (MBC215; a mixture of 5-chloro-2-methyl-4-isothiazolin-3-one and 2-methyl-4-isothiazolin) and the quaternary ammonium compound poly(oxyethylene) (dimethylimino) ethylene (dimethylimino) ethylene dichloride (). In addition, bacteria released through these vesicles were viable up to 6 months (). In the same way, it has been demonstrated that amoebae promote resuscitation of viable but non-culturable Legionella, enhancing in parallel their resistance to sodium hypochlorite (). The level of Legionella resistance into amoebae is also dependent of the disinfectant used. For example, monochloramine displays the same efficiency against planktonic bacteria in the presence or not of amoebae whereas chlorine and chlorine dioxide are less active against Legionella co-cultured with amoebae (). The understanding, at the molecular level, of the intra-protozoa acquired Legionella resistance (; ) is obviously an important information in order to develop strategies to limit or eradicate this phenomenon. Interestingly, it was also shown that L. pneumophila resistance against chlorine acquired into amoebae is host-dependent (), suggesting the involvement of specific molecular mechanisms currently unknown.
In conclusion, the use of biocides such as chlorine or chloramine to disinfect water appears to only limit the development of L. pneumophila without being able to eradicate this pathogen (). More critically, intracellularly grown L. pneumophila become more resistant when exposed to biocides (), suggesting that it is necessary to control, in water, both bacterial pathogens and their natural hosts like amoebae. In this way, studies of the direct impact of biocides on amoebae, alone or infected with a pathogen, would be very helpful (; , ; ). Noticeably, infected amoebae were shown to become more pathogenic than uninfected amoebae (), suggesting that the two partners (i.e., amoebae and L. pneumophila) enhance synergistically their pathogenesis. Therefore, studies dealing with treatments against Legionella should be performed on bacteria associated with their natural host in order to (i) determine how the bacteria are protected during their intracellular life cycle, (ii) if the passage inside host cells modifies the Legionella resistance after its escape, and (iii) how the host responds to treatments (; ; ).
Natural Biocides: An Alternative Way to Control L. pneumophila Spread in the Environment?
For a few years now, some studies have highlighted natural compounds with anti-Legionella properties. Why such an interest? Probably because (i) L. pneumophila is a waterborne bacterium ubiquitously found in freshwater environments, (ii) LD is a severe and sometimes fatal multisystem illness involving atypical pneumonia, (iii) the development of man-made water systems such as air-conditioners and cooling towers has expanded the environmental niche of L. pneumophila in association with amoebae, (iv) emerging pathogens such as L. pneumophila or spore-forming bacteria such as Bacillus are able to resist to currently used water disinfection procedures, and (v) more efforts are needed to control disinfection by-products and minimize people exposure to potentially hazardous chemicals (Trihalomethanes, Haloacetic acids…) while maintaining adequate disinfection and control of targeted pathogens while respecting the environment. Subsequently, we review in this chapter recent advances in finding natural compounds exhibiting direct or indirect anti-Legionella activity and discuss, if known, their mode of action.
Proteins
To date, only two proteins have been found to be directly active against Legionella cells: the greater wax moth Galleria mellonella apolipophorin III (ApoLp-III) and the human lactoferrin. The ApoLp-III protein family is composed of low-molecular weight apolipoproteins (161–166 amino acid residues) characterized by a globular amphipathic α-helix bundle conformation (). ApoLp-III has been shown to be an important component of hemolymph of numerous insect species of Orthoptera, Leptidoptera, Coleoptera, and Hemiptera genus. In addition, ApoLp-III is involved in lipid transport and immunity. Recently, the protein was recovered by methanol extraction, purified and evaluated against three Legionella species: L. dumoffii, L. pneumophila, and L. gormanii (; ; ). Antimicrobial assays demonstrated a difference in susceptibility among Legionella species. An 1-hincubation time of cells with 0.1 mg/ml of protein induced a moderate mortality rate of 55% for L. pneumophila vs. 40% for L. gormanii. The highest protein concentration tested in the studies, 0.4 mg/ml for L. dumoffii, 1.6 mg/ml for L. pneumophila, and 0.2 mg/ml for L. gormanii decreased the survival rate of 30, 100, and 50%, respectively. The effect of the protein on L. dumoffii was also investigated by transmission electron microscopy (). This study highlighted cell wall damages and strong intracellular alterations, such as increased vacuolization and condensation in the cytoplasm (Figure 1). Interestingly, cell envelope damages appeared greater for bacteria cultured on medium with choline supplementation (). Consistently, the sensitivity toward ApoLp-III of this species was threefold increased when cells were grown in the presence of choline. Extracellular choline is known to be used by some Legionella species for the synthesis of phosphatidylcholine (PC) that are phospholipids commonly found as component of eukaryotic membranes while only encountered in the envelope of about 15% of bacteria (; ; ). Based on these observations as well as atomic force microscopy (AFM), Fourier transform infrared spectroscopy (FTIR), and lipopolysaccharide (LPS) binding studies, the authors assumed that ApoLp-III interacts with lipid components of Legionella cell membrane (). Indeed, the protein most probably interacts with phospholipids (especially PC) of L. dumoffii while the anti-L. pneumophila effect is rather driven by interaction with LPS and other lipid components of its membrane. ApoLp-III shares homology with the 22-kDa N-terminal domain of the human apolipoprotein E (ApoE). This 37-kDa apolipoprotein has similar roles as ApoLp-III including lipid transport, host immunity as well as immunomodulatory properties. As for its insect homolog, SDS-PAGE and FTIR analysis revealed that ApoE strongly interacts with LPS of L. pneumophila outer membrane. However, although AFM analysis demonstrated alterations in the cell surface topography and properties, 0.8 mg/ml of protein did not reduce viability of L. pneumophila cells after an 1-h treatment ().
FIGURE 1
Lactoferrin is a glycoprotein of the transferrin family found at high levels in milk. The molecule, thanks to its ferric ions binding capacity, presents multiple biological functions. Indeed, lactoferrin is known to interact with the molecular and cellular components of hosts and pathogens (
Protein-Derived Peptides
Regarding protein-derived peptides, two synthetic fragments of protein were shown to have anti-Legionella activity. The first one, C18G (ALYKKLLKKLLKSAKKLG; 2043 Da), is based on the antimicrobial peptide C13 corresponding to the last 13 amino acids of the carboxyl terminus of human platelet factor IV. The peptide was designed to improve its antibacterial potency by increasing the length of C13 and substituting a negative charge with a positive charge (
When compared to C18G, another synthetic protein fragment named NK-2 demonstrated its efficacy in Legionella killing. NK-2 (KILRGVCKKIMRTFLRRISKDILTGKK; 3203 Da) was designed as the partial sequence of the porcine lymphatic effector protein NK-lysin corresponding to the core region of the protein (residues 39–65) (
Antimicrobial Peptides (AMPs)
Historically, the first antimicrobial peptides tested against L. pneumophila were some apidaecin-type peptides, consisting in proline-rich molecules isolated from various hymenopteran insects (
The first anti-Legionella peptides, produced by bacteria, were purified and characterized from the culture supernatant of a Staphylococcus warneri strain. This strain, S. warneri RK, was first detected as a contaminant colony on a L. pneumophila culture surrounded by a characteristic inhibition zone (
Table 1
| Peptide | Producing bacteria | Amino acids sequence (Nter–Ctter) | MIC (μM) | |
|---|---|---|---|---|
| Group 1 | Warnericin RK | S. warneri | MQFITDLIKKAVDFFKGLFGNK | 0.3 |
| δ-Lysin I* | S. warneri | MAADIISTIGDLVKLIINTVKKFQK | 1.08 | |
| δ-Lysin II | S. warneri | MTADIISTIGDFVKWILDTVKKFTK | 0.54 | |
| δ-Hemolysin | S. aureus | MAQDIISTIGDLVKWIIDTVNKFTKK | 1.05 | |
| Ggi I | S. haemolyticus | MQKLAEAIAAAVSAGQDKDWGKMGTSIVGIVENGITVLGKIFGF | 4.15 | |
| SLUSH C | S. lugdunensis | MDGIFEAISKAVQAGLDKDWATMGTSIAEALAKGVDFIIGLFH | 5.16 | |
| SLUSH A | S. lugdunensis | MSGIVDAITKAVQAGLDKDWATMATSIADAIAKGVDFIAGFFN | 11.28 | |
| Group 2 | PSMα | S. epidermidis | MADVIAKIVEIVKGLIDQFTQK | 0.63 |
| δ-Hemolysin | S. epidermidis | MMAADIISTIGDLVKWIIDTVNKFKK | 1.59 | |
| PSMβ | S. epidermidis | MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF | 2.69 | |
| H2U* | S. cohnii | MDFIIDIIKKIVGLFTGK | 3.04 | |
| Ggi II | S. haemolyticus | MEKIANAVKSAIEAGQNQDWTKLGTSILDIVSNGVTELSKIFGF | 13.23 | |
| Haemo 3 | S. haemolyticus | n.d. | 1.38 |
Anti-Legionella antimicrobial peptides (AMPs) produced by Staphylococci (Adapted from
Minimum inhibitory concentrations were determined against L. pneumophila Lens and for the formylated forms of the peptides except for the peptides indicated by *.
FIGURE 2

Structural model of warnericin RK in a membrane-like environment. Green: hydrophobic residues; Purple: hydrophilic and neutral residues; Blue: negatively charged residues; Red: positively charged residues (Source: Adapted from
Several anti-Legionella peptides have been found so far, mainly in bacteria belonging to the Staphylococcus genus (
On the basis of their antimicrobial [minimum inhibitory concentration (MIC), minimum permeabilization concentration, decrease of bacterial cultivability] and hemolytic activities, the purified peptides were separated into two groups (Table 1). The first group, including warnericin RK, corresponds to highly hemolytic and bactericidal peptides. The peptides of the second group, including PSMα from Staphylococcus epidermidis, are bacteriostatic and poorly hemolytic. Thus, a structure/activity relationships study was performed on the archetypes of each group of anti-Legionella peptides, warnericin RK and PSMα, in order to determine key amino acids (
Only the mode of action of warnericin RK has been studied in detail so far. A concentration of this peptide equals or superior to 3.12 μM was shown to fully suppress the growth ability of L. pneumophila (
The specific sensitivity of Legionella to warnericin RK, and probably to detergents, seems to be related to the lipid composition of its membrane and not to the presence of a dedicated proteinaceous receptor. This was confirmed by
Anti-Legionella activity of AMPs from a non-prokaryotic source was also described in the literature. To date only three peptides, among which two were derived from natural AMPs of the marine organism Ciona intestinalis and one was purified from the greater wax moth Galleria mellonella, have been studied. Ci-MAM-A and Ci-PAP-A are naturally present in the ascidian tunic as well as in granulocytes of inflamed tissues of C. intestinalis, thus constituting a chemical protection to microbial invasion for this organism (
FIGURE 3

Activity of Ci-MAM-A24 against intra-amoebic L. pneumophila observed by confocal microscopy.A. castellanii cells infected with GFP expressing L. pneumophila Lens were incubated 6 h post-infection with (A) 12.5 μM of Ci-MAM-A24 or (B) peptide solvent during 42 h (48 h post-infection) (Source:
The Galleria defensin, a 43 aminoacids long peptide (
Essential Oils (EOs)
Essential oils are aromatic oily liquids obtained from plant material such as flowers, buds, seeds, leaves, twigs, bark, herbs fruits, or roots, and are mainly composed of a mixture of terpenoïds and aromatic compounds. Among terpenes, monoterpenes, diterpenes, and sesquiterpenes are the most currently found (
Investigations were performed by
Table 2
| Common name of EO | Latin name of plant source | Major components | Approximate concentration (%) | *MBC100 (MIC) | Reference |
|---|---|---|---|---|---|
| Cinnamon | Cinnamomum osmophloeum | Trans-Cinnamaldehyde Benzenpropanal 4-allylanisole | 91.32 3.18 1.42 | 1000 μg/ml | |
| Tea tree | Melaleuca alternifolia | Terpinen-4-ol 1,8-Cineole | 42.35 3.57 | 0.5% v/v | |
| Juniper | Juniperus phoenicea | Isoborneol 1S-α-Pinene | 20.91 18.30 | (0.03 mg/ml) | |
| Thyme | Thymus vulgaris | Carvacrol | 88.50 | (0.07 mg/ml) |
Major components and minimum bactericidal concentration (MBC) or MIC of EOs that exhibit anti-Legionella pneumophila properties.
*MBC100: The minimum bactericidal concentration of EO that inactivated at least 99.9% of the bacteria. MICs values are indicated in brackets.
In
Recently, the effects of Citrus EOs vapors were tested on different strains of Legionella in water and soil systems (
More recently, results obtained by
In regard to EOs composition and relative abundance variabilities, their antibacterial activity could not be link to one specific mechanism as cells possess several targets (
FIGURE 4

Anti-Legionella activity of Thymus vulgaris EO observed by transmission electron microscopy. Micrographs of (A) untreated control cells of L. pneumophila Lens strain and (B) treated L. pneumophila Lens with 70 μg/ml Thymus vulgaris EO (Source:
Biosurfactants
Biosurfactants are a structurally diverse group of surface-active molecules produced by various microorganisms: bacteria, yeasts or fungi (
Lipopeptides, which constitute a specific class of microbial secondary metabolites, are well identified as antimicrobial agents (
Table 3
| Target bacteria | MIC | Producing strain | Antibacterial Assay | Reference |
|---|---|---|---|---|
| E. coli AS1.487 | 15.625 μg/ml | Commercially purchased | Microdilution | |
| P. syringae pv tomato DC3000 | 25 μg/ml | Commercially purchased | Microdilution | |
| L. monocytogenes 99/287RB6 strains | 125 μg/ml 250 μg/ml 1 mg/ml | B. subtilis C4 B. subtilis G2III B. subtilis M1 | *WDA | |
| S. enteritidis | 6.25 μg/ml | Commercially purchased | Microdilution | |
| V. anguillarum | 1.5 μg/ml | B. amyloliquefaciens M1 | Not specified | |
| Legionella sp. | 1–4 μg/ml | Commercially purchased | Microdilution | |
| M. pulmonis MpUR1.1 | 25.9 μg/ml | Commercially purchased | Microdilution |
Minimum inhibitory concentrations (MIC) of purified or commercially purchased surfactins against selected bacterial strains.
*WDA: well diffusion assay.
Minimum inhibitory concentrations were determined against L. pneumophila Lens and for the formylated forms of the peptides except for the peptides indicated by *.
FIGURE 5

Apotome imaging of surfactin-treated 6-day-old biofilms formed by L. pneumophila. Biofilms were treated 2 h either with (A) ethanol as control or (B) 66 μg/ml surfactin (Source:
Concerning their mechanism of action, surfactins seem to act by direct lysis of negatively charged membranes (
Conclusion
Legionella pneumophila appears sensitive to various biomolecules including molecules that are poorly active against others bacteria like surfactin. However, it is important to keep in mind that L. pneumophila is not a routinely used bacterium when determining the antimicrobial potency of a given product in contrast to bacteria such as E. coli, S. aureus, or P. aeruginosa. Therefore, it is easy to understand why there are so little known anti-Legionella molecules available in the literature. On the other hand, the described compounds are very active against L. pneumophila compared to other bacteria. Does L. pneumophila possess some specificity that could explain this sensitivity? As all these compounds are membrane active, maybe a part of the answer is hidden in the composition of L. pneumophila cell envelope. The current knowledge about the structure and molecular composition of its cell envelope was recently reviewed, and authors highlighted several characteristics that deserve more attention (
Statements
Author contributions
J-MB, SC, and JV conceived and designed the review. J-MB, SC, MS, EP, CL, WA, OL, and JV wrote the paper. JV coordinated the work.
Acknowledgments
This work received financial support from the French National Research Program for Environmental and Occupational Health of ANSES, grant EST-2015/1/111.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
References
1
Abdel-NourM.DuncanC.LowD. E.GuyardC. (2013). Biofilms: the stronghold of Legionella pneumophila.Int. J. Mol. Sci.1421660–21675. 10.3390/ijms141121660
2
Abu KwaikY.GaoL. Y.StoneB. J.VenkataramanC.HarbO. S. (1998). Invasion of protozoa by Legionella pneumophila and its role in bacterial ecology and pathogenesis.Appl. Environ. Microbiol.643127–3133.
3
Al-QuadanT.PriceC. T.Abu KwaikY. (2012). Exploitation of evolutionarily conserved amoeba and mammalian processes by Legionella.Trends Microbiol.20299–306. 10.1016/j.tim.2012.03.005
4
AndraJ.LeippeM. (1999). Candidacidal activity of shortened synthetic analogs of amoebapores and NK-lysin.Med. Microbiol. Immunol.188117–124. 10.1007/s004300050113
5
BaisH. P.FallR.VivancoJ. M. (2004). Biocontrol of Bacillus subtilis against infection of Arabidopsis roots by Pseudomonas syringae is facilitated by biofilm formation and surfactin production.Plant Physiol.134307–319. 10.1104/pp.103.028712
6
BakkaliF.AverbeckS.AverbeckD.IdaomarM. (2008). Biological effects of essential oils–a review.Food Chem. Toxicol.46446–475. 10.1016/j.fct.2007.09.106
7
BarkerJ.BrownM. R.CollierP. J.FarrellI.GilbertP. (1992). Relationship between Legionella pneumophila and Acanthamoeba polyphaga: physiological status and susceptibility to chemical inactivation.Appl. Environ. Microbiol.582420–2425.
8
BarkerJ.ScaifeH.BrownM. R. (1995). Intraphagocytic growth induces an antibiotic-resistant phenotype of Legionella pneumophila.Antimicrob. Agents Chemother.392684–2688. 10.1128/AAC.39.12.2684
9
BeauteJ.ZucsP.de JongB.European Legionnaires’ Disease SurveillanceN. (2013). Legionnaires disease in Europe, 2009-2010.Euro. Surveill.18:20417.
10
BechingerB.LohnerK. (2006). Detergent-like actions of linear amphipathic cationic antimicrobial peptides.Biochim. Biophys. Acta17581529–1539. 10.1016/j.bbamem.2006.07.001
11
BerkS. G.TingR. S.TurnerG. W.AshburnR. J. (1998). Production of respirable vesicles containing live Legionella pneumophila cells by two Acanthamoeba spp.Appl. Environ. Microbiol.64279–286.
12
BerryD.XiC.RaskinL. (2006). Microbial ecology of drinking water distribution systems.Curr. Opin. Biotechnol17297–302. 10.1016/j.copbio.2006.05.007
13
BlascoM. D.EsteveC.AlcaideE. (2008). Multiresistant waterborne pathogens isolated from water reservoirs and cooling systems.J. Appl. Microbiol.105469–475. 10.1111/j.1365-2672.2008.03765.x
14
BorellaP.GuerrieriE.MarchesiI.BondiM.MessiP. (2005). Water ecology of Legionella and protozoan: environmental and public health perspectives.Biotechnol. Annu. Rev.11355–380. 10.1016/S1387-2656(05)11011-4
15
BortnerC. A.ArnoldR. R.MillerR. D. (1989). Bactericidal effect of lactoferrin on Legionella pneumophila: effect of the physiological state of the organism.Can. J. Microbiol.351048–1051. 10.1139/m89-174
16
BortnerC. A.MillerR. D.ArnoldR. R. (1986). Bactericidal effect of lactoferrin on Legionella pneumophila.Infect. Immun.51373–377.
17
BouyerS.ImbertC.RodierM. H.HechardY. (2007). Long-term survival of Legionella pneumophila associated with Acanthamoeba castellanii vesicles.Environ. Microbiol.91341–1344. 10.1111/j.1462-2920.2006.01229.x
18
BrielandJ. K.FantoneJ. C.RemickD. G.LeGendreM.McClainM.EnglebergN. C. (1997). The role of Legionella pneumophila-infected Hartmannella vermiformis as an infectious particle in a murine model of Legionnaire’s disease.Infect. Immun.655330–5333.
19
BuchouxS.Lai-Kee-HimJ.GarnierM.TsanP.BessonF.BrissonA.et al (2008). Surfactin-triggered small vesicle formation of negatively charged membranes: a novel membrane-lysis mechanism.Biophys. J.953840–3849. 10.1529/biophysj.107.128322
20
BurtS. (2004). Essential oils: their antibacterial properties and potential applications in foods–a review.Int. J. Food Microbiol.94223–253. 10.1016/j.ijfoodmicro.2004.03.022
21
BuseH. Y.LuJ.LuX.MouX.AshboltN. J. (2014). Microbial diversities (16S and 18S rRNA gene pyrosequencing) and environmental pathogens within drinking water biofilms grown on the common premise plumbing materials unplasticized polyvinylchloride and copper.FEMS Microbiol. Ecol.88280–295. 10.1111/1574-6941.12294
22
CampeseC.BitarD.JarraudS.MaineC.ForeyF.EtienneJ.et al (2011). Progress in the surveillance and control of Legionella infection in France, 1998-2008.Int. J. Infect. Dis.15e30–e37. 10.1016/j.ijid.2010.09.007
23
CarsonC. F.MeeB. J.RileyT. V. (2002). Mechanism of action of Melaleuca alternifolia (tea tree) oil on Staphylococcus aureus determined by time-kill, lysis, leakage, and salt tolerance assays and electron microscopy.Antimicrob. Agents Chemother.461914–1920. 10.1128/AAC.46.6.1914-1920.2002
24
CasteelsP.RomagnoloJ.CastleM.Casteels-JossonK.Erdjument-BromageH.TempstP. (1994). Biodiversity of apidaecin-type peptide antibiotics. Prospects of manipulating the antibacterial spectrum and combating acquired resistance.J. Biol. Chem.26926107–26115.
25
Cervero-AragoS.Rodriguez-MartinezS.Puertas-BennasarA.AraujoR. M. (2015). Effect of common drinking water disinfectants, chlorine and heat, on free Legionella and amoebae-associated Legionella.PLoS ONE10:e0134726. 10.1371/journal.pone.0134726
26
ChaftarN.GirardotM.LabanowskiJ.GhrairiT.HaniK.FrereJ.et al (2015a). Comparative evaluation of the antimicrobial activity of 19 essential oils.Adv. Exp. Med. Biol.10.1007/5584_2015_5011[Epub ahead of print].
27
ChaftarN.GirardotM.QuellardN.LabanowskiJ.GhrairiT.HaniK.et al (2015b). Activity of six essential oils extracted from tunisian plants against Legionella pneumophila.Chem Biodivers.121565–1574. 10.1002/cbdv.201400343
28
ChangC. W.ChangW. L.ChangS. T. (2008a). Influence of pH on bioactivity of cinnamon oil against Legionella pneumophila and its disinfection efficacy in hot springs.Water Res425022–5030. 10.1016/j.watres.2008.09.006
29
ChangC. W.ChangW. L.ChangS. T.ChengS. S. (2008b). Antibacterial activities of plant essential oils against Legionella pneumophila.Water Res.42278–286. 10.1016/j.watres.2007.07.008
30
ChangC. W.KaoC. H.LiuY. F. (2009). Heterogeneity in chlorine susceptibility for Legionella pneumophila released from Acanthamoeba and Hartmannella.J. Appl. Microbiol.10697–105. 10.1111/j.1365-2672.2008.03980.x
31
ChmielE.Palusinska-SzyszM.Zdybicka-BarabasA.CytrynskaM.MakP. (2014). The effect of Galleria mellonella hemolymph polypeptides on Legionella gormanii.Acta Biochim. Pol.61123–127.
32
CirilloJ. D.FalkowS.TompkinsL. S. (1994). Growth of Legionella pneumophila in Acanthamoeba castellanii enhances invasion.Infect. Immun.623254–3261.
33
CollierS. A.StockmanL. J.HicksL. A.GarrisonL. E.ZhouF. J.BeachM. J. (2012). Direct healthcare costs of selected diseases primarily or partially transmitted by water.Epidemiol. Infect.1402003–2013. 10.1017/S0950268811002858
34
ConoverG. M.Martinez-MoralesF.HeidtmanM. I.LuoZ. Q.TangM.ChenC.et al (2008). Phosphatidylcholine synthesis is required for optimal function of Legionella pneumophila virulence determinants.Cell Microbiol.10514–528. 10.1111/j.1462-5822.2007.01066.x
35
CooperI. R.HanlonG. W. (2010). Resistance of Legionella pneumophila serotype 1 biofilms to chlorine-based disinfection.J. Hosp. Infect.74152–159. 10.1016/j.jhin.2009.07.005
36
CooperI. R.WhiteJ.MahenthiralingamE.HanlonG. W. (2008). Long-term persistence of a single Legionella pneumophila strain possessing the mip gene in a municipal shower despite repeated cycles of chlorination.J. Hosp. Infect.70154–159. 10.1016/j.jhin.2008.06.015
37
CytrynskaM.MakP.Zdybicka-BarabasA.SuderP.JakubowiczT. (2007). Purification and characterization of eight peptides from Galleria mellonella immune hemolymph.Peptides28533–546. 10.1016/j.peptides.2006.11.010
38
DarveauR. P.BlakeJ.SeachordC. L.CosandW. L.CunninghamM. D.Cassiano-CloughL.et al (1992). Peptides related to the carboxyl terminus of human platelet factor IV with antibacterial activity.J. Clin. Invest.90447–455. 10.1172/JCI115880
39
DeclerckP.BehetsJ.DelaedtY.MargineanuA.LammertynE.OllevierF. (2005). Impact of non-Legionella bacteria on the uptake and intracellular replication of Legionella pneumophila in Acanthamoeba castellanii and Naegleria lovaniensis.Microb. Ecol.50536–549. 10.1007/s00248-005-0258-0
40
DeclerckP.BehetsJ.van HoefV.OllevierF. (2007). Detection of Legionella spp. and some of their amoeba hosts in floating biofilms from anthropogenic and natural aquatic environments.Water Res.413159–3167. 10.1016/j.watres.2007.04.011
41
Di BellaM. A.FeddersH.De LeoG.LeippeM. (2011). Localization of antimicrobial peptides in the tunic of Ciona intestinalis (Ascidiacea, Tunicata) and their involvement in local inflammatory-like reactions.Results Immunol.170–75. 10.1016/j.rinim.2011.09.001
42
DominguezA.AlvarezJ.SabriaM.CarmonaG.TornerN.OviedoM.et al (2009). Factors influencing the case-fatality rate of Legionnaires’ disease.Int. J. Tuberc. Lung Dis.13407–412.
43
DonlanR. M.CostertonJ. W. (2002). Biofilms: survival mechanisms of clinically relevant microorganisms.Clin. Microbiol. Rev.15167–193. 10.1128/CMR.15.2.167-193.2002
44
DonlanR. M.ForsterT.MurgaR.BrownE.LucasC.CarpenterJ.et al (2005). Legionella pneumophila associated with the protozoan Hartmannella vermiformis in a model multi-species biofilm has reduced susceptibility to disinfectants.Biofouling211–7. 10.1080/08927010500044286
45
DormanH. J.DeansS. G. (2000). Antimicrobial agents from plants: antibacterial activity of plant volatile oils.J. Appl. Microbiol.88308–316. 10.1046/j.1365-2672.2000.00969.x
46
DupuyM.MazouaS.BerneF.BodetC.GarrecN.HerbelinP.et al (2011). Efficiency of water disinfectants against Legionella pneumophila and Acanthamoeba.Water Res.451087–1094. 10.1016/j.watres.2010.10.025
47
EmtiaziF.SchwartzT.MartenS. M.Krolla-SidensteinP.ObstU. (2004). Investigation of natural biofilms formed during the production of drinking water from surface water embankment filtration.Water Res.381197–1206. 10.1016/j.watres.2003.10.056
48
FalkinhamJ. O.PrudenA.EdwardsM. (2015). Opportunistic premise plumbing pathogens: increasingly important pathogens in drinking water.Pathogens4373–386. 10.3390/pathogens4020373
49
Fassi FehriL.WróblewskiH.BlanchardA. (2007). Activities of antimicrobial peptides and synergy with enrofloxacin against Mycoplasma pulmonis.Antimicrob. Agents Chemother.51468–474. 10.1128/AAC.01030-06
50
FeddersH.LeippeM. (2008). A reverse search for antimicrobial peptides in Ciona intestinalis: identification of a gene family expressed in hemocytes and evaluation of activity.Dev. Comp. Immunol.32286–298. 10.1016/j.dci.2007.06.003
51
FeddersH.MichalekM.GrotzingerJ.LeippeM. (2008). An exceptional salt-tolerant antimicrobial peptide derived from a novel gene family of haemocytes of the marine invertebrate Ciona intestinalis.Biochem. J.41665–75. 10.1042/BJ20080398
52
FieldsB. S.BensonR. F.BesserR. E. (2002). Legionella and Legionnaires’ disease: 25 years of investigation.Clin. Microbiol. Rev.15506–526. 10.1128/CMR.15.3.506-526.2002
53
FouqueE.YefimovaM.TrouilheM. C.QuellardN.FernandezB.RodierM. H.et al (2015). Morphological study of the encystment and excystment of vermamoeba vermiformis revealed original traits.J. Eukaryot. Microbiol.62327–337. 10.1111/jeu.12185
54
FrancoI. S.ShumanH. A.CharpentierX. (2009). The perplexing functions and surprising origins of Legionella pneumophila type IV secretion effectors.Cell Microbiol.111435–1443. 10.1111/j.1462-5822.2009.01351.x
55
FraserD. W.TsaiT. R.OrensteinW.ParkinW. E.BeechamH. J.SharrarR. G.et al (1977). Legionnaires’ disease: description of an epidemic of pneumonia.N. Engl. J. Med.2971189–1197. 10.1056/NEJM197712012972201
56
GarciaM. T.JonesS.PelazC.MillarR. D.Abu KwaikY. (2007). Acanthamoeba polyphaga resuscitates viable non-culturable Legionella pneumophila after disinfection.Environ. Microbiol.91267–1277. 10.1111/j.1462-2920.2007.01245.x
57
GardunoR. A.GardunoE.HiltzM.HoffmanP. S. (2002). Intracellular growth of Legionella pneumophila gives rise to a differentiated form dissimilar to stationary-phase forms.Infect. Immun.706273–6283. 10.1128/IAI.70.11.6273-6283.2002
58
GeigerO.Lopez-LaraI. M.SohlenkampC. (2013). Phosphatidylcholine biosynthesis and function in bacteria.Biochim. Biophys. Acta1831503–513. 10.1016/j.bbalip.2012.08.009
59
GelhausC.JacobsT.AndraJ.LeippeM. (2008). The antimicrobial peptide NK-2 the core region of mammalian NK-lysin, kills intraerythrocytic Plasmodium falciparum.Antimicrob. Agents Chemother.521713–1720. 10.1128/AAC.01342-07
60
GiaoM. S.WilksS.AzevedoN. F.VieiraM. J.KeevilC. W. (2009). Incorporation of natural uncultivable Legionella pneumophila into potable water biofilms provides a protective niche against chlorination stress.Biofouling25335–341. 10.1080/08927010902802232
61
GudinaE. J.RangarajanV.SenR.RodriguesL. R. (2013). Potential therapeutic applications of biosurfactants.Trends Pharmacol. Sci.34667–675. 10.1016/j.tips.2013.10.002
62
GuoL.LimK. B.PodujeC. M.DanielM.GunnJ. S.HackettM.et al (1998). Lipid A acylation and bacterial resistance against vertebrate antimicrobial peptides.Cell95189–198. 10.1016/S0092-8674(00)81750-X
63
GustafsonJ. E.LiewY. C.ChewS.MarkhamJ.BellH. C.WyllieS. G.et al (1998). Effects of tea tree oil on Escherichia coli.Lett. Appl. Microbiol.26194–198. 10.1046/j.1472-765X.1998.00317.x
64
HamiltonE.SealD. V.HayJ. (1996). Comparison of chlorine and chlorine dioxide disinfection for control of Legionella in a hospital potable water supply.J. Hosp. Infect.32156–160. 10.1016/S0195-6701(96)90058-4
65
HaneyE. F.HunterH. N.MatsuzakiK.VogelH. J. (2009). Solution NMR studies of amphibian antimicrobial peptides: linking structure to function?Biochim. Biophys. Acta17881639–1655. 10.1016/j.bbamem.2009.01.002
66
HechardY.FerrazS.BruneteauE.SteinertM.BerjeaudJ. M. (2005). Isolation and characterization of a Staphylococcus warneri strain producing an anti-Legionella peptide.FEMS Microbiol. Lett.25219–23. 10.1016/j.femsle.2005.03.046
67
HelanderI. M.AlakomiH. L.Latva-KalaK.Mattila-SandholmT.PolI.SmidE. J.et al (1998). Characterization of the action of selected essential oil components on gram-negative bacteria.J. Agric. Food Chem.463590–3595. 10.1021/jf980154m
68
HilbiH.HoffmannC.HarrisonC. F. (2011). Legionella spp. outdoors: colonization, communication and persistence.Environ. Microbiol. Rep.3286–296. 10.1111/j.1758-2229.2011.00247.x
69
HindahlM. S.IglewskiB. H. (1984). Isolation and characterization of the Legionella pneumophila outer membrane.J. Bacteriol.159107–113.
70
HuangX.SuoJ.CuiY. (2011). Optimization of antimicrobial activity of surfactin and polylysine against Salmonella enteritidis in milk evaluated by a response surface methodology.Foodborne Pathog. Dis.8439–443. 10.1089/fpd.2010.0738
71
HuangX.WeiZ.ZhaoG.GaoX.YangS.CuiY. (2008). Optimization of sterilization of Escherichia coli in milk by surfactin and fengycin using a response surface method.Curr. Microbiol.56376–381. 10.1007/s00284-007-9066-8
72
HubberA.RoyC. R. (2010). Modulation of host cell function by Legionella pneumophila type IV effectors.Annu. Rev. Cell Dev. Biol.26261–283. 10.1146/annurev-cellbio-100109-104034
73
InesM.DhouhaG. (2015). Lipopeptide surfactants: production, recovery and pore forming capacity.Peptides71100–112. 10.1016/j.peptides.2015.07.006
74
IsbergR. R.O’ConnorT. J.HeidtmanM. (2009). The Legionella pneumophila replication vacuole: making a cosy niche inside host cells.Nat. Rev. Microbiol.713–24. 10.1038/nrmicro1967
75
JacobsT.BruhnH.GaworskiI.FleischerB.LeippeM. (2003). NK-lysin and its shortened analog NK-2 exhibit potent activities against Trypanosoma cruzi.Antimicrob. Agents Chemother.47607–613. 10.1128/AAC.47.2.607-613.2003
76
JenaP.MishraB.LeippeM.HasilikA.GriffithsG.SonawaneA. (2011). Membrane-active antimicrobial peptides and human placental lysosomal extracts are highly active against mycobacteria.Peptides32881–887. 10.1016/j.peptides.2011.03.002
77
JenssenH.HancockR. E. (2009). Antimicrobial properties of lactoferrin.Biochimie9119–29. 10.1016/j.biochi.2008.05.015
78
JjembaP. K.JohnsonW.BukhariZ.LeChevallierM. W. (2015). Occurrence and control of Legionella in recycled water systems.Pathogens4470–502. 10.3390/pathogens4030470
79
JuglalS.GovindenR.OdhavB. (2002). Spice oils for the control of co-occurring mycotoxin-producing fungi.J. Food Prot.65683–687.
80
KarpouhtsisI.PardaliE.FeggouE.KokkiniS.ScourasZ. G.Mavragani-TsipidouP. (1998). Insecticidal and genotoxic activities of oregano essential oils.J. Agric. Food Chem.461111–1115. 10.1021/jf970822o
81
KimB. R.AndersonJ. E.MuellerS. A.GainesW. A.KendallA. M. (2002). Literature review–efficacy of various disinfectants against Legionella in water systems.Water Res.364433–4444. 10.1016/S0043-1354(02)00188-4
82
KoubarM.RodierM. H.GardunoR. A.FrereJ. (2011). Passage through Tetrahymena tropicalis enhances the resistance to stress and the infectivity of Legionella pneumophila.FEMS Microbiol. Lett.32510–15. 10.1111/j.1574-6968.2011.02402.x
83
LaabeiM.JamiesonW. D.YangY.van den ElsenJ.JenkinsA. T. (2014). Investigating the lytic activity and structural properties of Staphylococcus aureus phenol soluble modulin (PSM) peptide toxins.Biochim. Biophys. Acta18383153–3161. 10.1016/j.bbamem.2014.08.026
84
LairdK.KurzbachE.ScoreJ.TejpalJ.Chi TangyieG.PhillipsC. (2014). Reduction of Legionella spp. in water and in soil by a citrus plant extract vapor.Appl. Environ. Microbiol.806031–6036. 10.1128/AEM.01275-14
85
LambertR. J.SkandamisP. N.CooteP. J.NychasG. J. (2001). A study of the minimum inhibitory concentration and mode of action of oregano essential oil, thymol and carvacrol.J. Appl. Microbiol.91453–462. 10.1046/j.1365-2672.2001.01428.x
86
LangS. (2002). Biological amphiphiles (microbial biosurfactants).Curr. Opin. Colloid Interface Sci.712–20. 10.1016/S1359-0294(02)00007-9
87
LauH. Y.AshboltN. J. (2009). The role of biofilms and protozoa in Legionella pathogenesis: implications for drinking water.J. Appl. Microbiol.107368–378. 10.1111/j.1365-2672.2009.04208.x
88
LeeJ. Y.BomanA.SunC. X.AnderssonM.JornvallH.MuttV.et al (1989). Antibacterial peptides from pig intestine: isolation of a mammalian cecropin.Proc. Natl. Acad. Sci. U.S.A.869159–9162. 10.1073/pnas.86.23.9159
89
LeeK. H.FittonJ. E.WuthrichK. (1987). Nuclear magnetic resonance investigation of the conformation of delta-haemolysin bound to dodecylphosphocholine micelles.Biochim. Biophys. Acta911144–153. 10.1016/0167-4838(87)90003-3
90
LeippeM. (1995). Ancient weapons: NK-lysin, is a mammalian homolog to pore-forming peptides of a protozoan parasite.Cell8317–18. 10.1016/0092-8674(95)90229-5
91
LiuZ.StoutJ. E.BoldinM.RughJ.DivenW. F.YuV. L. (1998). Intermittent use of copper-silver ionization for Legionella control in water distribution systems: a potential option in buildings housing individuals at low risk of infection.Clin. Infect. Dis.26138–140. 10.1086/516283
92
LoiseauC.SchlusselhuberM.BigotR.BertauxJ.BerjeaudJ. M.VerdonJ. (2015). Surfactin from Bacillus subtilis displays an unexpected anti-Legionella activity.Appl. Microbiol. Biotechnol.995083–5093. 10.1007/s00253-014-6317-z
93
LoretJ. F.GreubG. (2010). Free-living amoebae: biological by-passes in water treatment.Int. J. Hyg. Environ. Health213167–175. 10.1016/j.ijheh.2010.03.004
94
MallegolJ.FernandesP.MelanoR. G.GuyardC. (2014). Antimicrobial activity of solithromycin against clinical isolates of Legionella pneumophila serogroup 1.Antimicrob. Agents Chemother.58909–915. 10.1128/AAC.01639-13
95
MarchandA.AugenstreichJ.LoiseauC.VerdonJ.LecomteS.BerjeaudJ. M. (2015). Effect of amino acid substitution in the staphylococcal peptides warnericin RK and PSMalpha on their anti-Legionella and hemolytic activities.Mol. Cell. Biochem.405159–167. 10.1007/s11010-015-2407-1
96
MarchandA.VerdonJ.LacombeC.CrapartS.HechardY.BerjeaudJ. M. (2011). Anti-Legionella activity of staphylococcal hemolytic peptides.Peptides32845–851. 10.1016/j.peptides.2011.01.025
97
MariM.BertoliniP.PratellaG. C. (2003). Non-conventional methods for the control of post-harvest pear diseases.J. Appl. Microbiol.94761–766. 10.1046/j.1365-2672.2003.01920.x
98
Martinez-MoralesF.SchobertM.Lopez-LaraI. M.GeigerO. (2003). Pathways for phosphatidylcholine biosynthesis in bacteria.Microbiology1493461–3471. 10.1099/mic.0.26522-0
99
McDadeJ. E.ShepardC. C.FraserD. W.TsaiT. R.RedusM. A.DowdleW. R. (1977). Legionnaires’ disease: isolation of a bacterium and demonstration of its role in other respiratory disease.N. Engl. J. Med.2971197–1203. 10.1056/NEJM197712012972202
100
MirelesJ. R.IIToguchiA.HarsheyR. M. (2001). Salmonella enterica serovar typhimurium swarming mutants with altered biofilm-forming abilities: surfactin inhibits biofilm formation.J. Bacteriol.1835848–5854. 10.1128/JB.183.20.5848-5854.2001
101
MkaddemM.BouajilaJ.EnnajarM.LebrihiA.MathieuF.RomdhaneM. (2009). Chemical composition and antimicrobial and antioxidant activities of Mentha (longifolia L. and viridis) essential oils.J. Food Sci.74M358–M363. 10.1111/j.1750-3841.2009.01272.x
102
MogoaE.BodetC.LegubeB.HechardY. (2010). Acanthamoeba castellanii: cellular changes induced by chlorination.Exp. Parasitol.12697–102. 10.1016/j.exppara.2009.12.005
103
MogoaE.BodetC.MorelF.RodierM. H.LegubeB.HechardY. (2011). Cellular response of the amoeba Acanthamoeba castellanii to chlorine, chlorine dioxide, and monochloramine treatments.Appl. Environ. Microbiol.774974–4980. 10.1128/AEM.00234-11
104
MondelloF.GirolamoA.ScaturroM.RicciM. L. (2009). Determination of Legionella pneumophila susceptibility to Melaleuca alternifolia Cheel (tea tree) oil by an improved broth micro-dilution method under vapour controlled conditions.J. Microbiol. Methods77243–248. 10.1016/j.mimet.2009.02.012
105
MoraI.CabrefigaJ.MontesinosE. (2015). Cyclic lipopeptide biosynthetic genes and products, and inhibitory activity of plant-associated Bacillus against phytopathogenic bacteria.PLoS ONE10:e0127738. 10.1371/journal.pone.0127738
106
NevesI. A.da CamaraC. A. (2011). Acaricidal activity against Tetranychus urticae and essential oil composition of four croton species from Caatinga biome in northeastern Brazil.Nat. Prod. Commun.6893–899.
107
OngenaM.JacquesP. (2008). Bacillus lipopeptides: versatile weapons for plant disease biocontrol.Trends Microbiol.16115–125. 10.1016/j.tim.2007.12.009
108
Pacwa-PlociniczakM.PlazaG. A.Piotrowska-SegetZ.CameotraS. S. (2011). Environmental applications of biosurfactants: recent advances.Int. J. Mol. Sci.12633–654. 10.3390/ijms12010633
109
Palusinska-SzyszM.Zdybicka-BarabasA.CytrynskaM.Wdowiak-WrobelS.ChmielE.GruszeckiW. I. (2015). Analysis of cell surface alterations in Legionella pneumophila cells treated with human apolipoprotein E.Pathog. Dis.731–8. 10.1111/2049-632X.12214
110
Palusinska-SzyszM.Zdybicka-BarabasA.Pawlikowska-PawlegaB.MakP.CytrynskaM. (2012). Anti-Legionella dumoffii activity of Galleria mellonella defensin and apolipophorin III.Int. J. Mol. Sci.1317048–17064. 10.3390/ijms131217048
111
PrasharA.TerebiznikM. R. (2015). Legionella pneumophila: homeward bound away from the phagosome.Curr. Opin. Microbiol.2386–93. 10.1016/j.mib.2014.11.008
112
ReichlingJ.KochC.Stahl-BiskupE.SojkaC.SchnitzlerP. (2005). Virucidal activity of a beta-triketone-rich essential oil of Leptospermum scoparium (manuka oil) against HSV-1 and HSV-2 in cell culture.Planta Med.711123–1127. 10.1055/s-2005-873175
113
RichardsC. L.BroadawayS. C.EggersM. J.DoyleJ.PyleB. H.CamperA. K.et al (2015). Detection of pathogenic and non-pathogenic bacteria in drinking water and associated biofilms on the crow reservation, Montana, USA.Microb. Ecol.10.1007/s00248-015-0595-6[Epub ahead of print].
114
RobeyM.O’ConnellW.CianciottoN. P. (2001). Identification of Legionella pneumophila rcp, a pagP-like gene that confers resistance to cationic antimicrobial peptides and promotes intracellular infection.Infect. Immun.694276–4286. 10.1128/IAI.69.7.4276-4286.2001
115
RodriguesI. A.AzevedoM. M.ChavesF. C.BizzoH. R.Corte-RealS.AlvianoD. S.et al (2013). In vitro cytocidal effects of the essential oil from Croton cajucara (red sacaca) and its major constituent 7- hydroxycalamenene against Leishmania chagasi.BMC Complement Altern. Med.13:249. 10.1186/1472-6882-13-249
116
RogersJ.DowsettA. B.DennisP. J.LeeJ. V.KeevilC. W. (1994). Influence of temperature and plumbing material selection on biofilm formation and growth of Legionella pneumophila in a model potable water system containing complex microbial flora.Appl. Environ. Microbiol.601585–1592.
117
SabateD. C.AudisioM. C. (2013). Inhibitory activity of surfactin, produced by different Bacillus subtilis subsp. subtilis strains, against Listeria monocytogenes sensitive and bacteriocin-resistant strains.Microbiol. Res.168125–129. 10.1016/j.micres.2012.11.004
118
SabyS.VidalA.SutyH. (2005). Resistance of Legionella to disinfection in hot water distribution systems.Water Sci. Technol.5215–28.
119
SaddiM.SannaA.CottigliaF.ChisuL.CasuL.BonsignoreL.et al (2007). Antiherpevirus activity of Artemisia arborescens essential oil and inhibition of lateral diffusion in Vero cells.Ann. Clin. Microbiol. Antimicrob.6:10. 10.1186/1476-0711-6-10
120
Sanli-YuruduN. O.Kimiran-ErdemA.CotukA. (2007). Studies on the efficacy of Chloramine T trihydrate (N-chloro-p-toluene sulfonamide) against planktonic and sessile populations of different Legionella pneumophila strains.Int. J. Hyg. Environ. Health210147–153. 10.1016/j.ijheh.2006.08.004
121
SchlusselhuberM.HumblotV.CasaleS.MethivierC.VerdonJ.LeippeM.et al (2015). Potent antimicrobial peptides against Legionella pneumophila and its environmental host, Acanthamoeba castellanii.Appl. Microbiol. Biotechnol.994879–4891. 10.1007/s00253-015-6381-z
122
Schroder-BormH.WillumeitR.BrandenburgK.AndraJ. (2003). Molecular basis for membrane selectivity of NK-2 a potent peptide antibiotic derived from NK-lysin.Biochim. Biophys. Acta1612164–171. 10.1016/S0005-2736(03)00115-9
123
SchwartzT.HoffmannS.ObstU. (2003). Formation of natural biofilms during chlorine dioxide and u.v. disinfection in a public drinking water distribution system.J. Appl. Microbiol.95591–601. 10.1046/j.1365-2672.2003.02019.x
124
SenR. (2010). Surfactin: biosynthesis, genetics and potential applications.Adv. Exp. Med. Biol.672316–323. 10.1007/978-1-4419-5979-9_24
125
SeowY. X.YeoC. R.ChungH. L.YukH. G. (2014). Plant essential oils as active antimicrobial agents.Crit. Rev. Food Sci. Nutr.54625–644. 10.1080/10408398.2011.599504
126
ShevchukO.JagerJ.SteinertM. (2011). Virulence properties of the Legionella pneumophila cell envelope.Front. Microbiol.2:74. 10.3389/fmicb.2011.00074
127
SilvaN.AlvesS.GoncalvesA.AmaralJ. S.PoetaP. (2013). Antimicrobial activity of essential oils from Mediterranean aromatic plants against several foodborne and spoilage bacteria.Food Sci. Technol. Int.19503–510. 10.1177/1082013212442198
128
SimoesL. C.SimoesM.VieiraM. J. (2010). Influence of the diversity of bacterial isolates from drinking water on resistance of biofilms to disinfection.Appl. Environ. Microbiol.766673–6679. 10.1128/AEM.00872-10
129
Siqueiros-CendonT.Arevalo-GallegosS.Iglesias-FigueroaB. F.Garcia-MontoyaI. A.Salazar-MartinezJ.Rascon-CruzQ. (2014). Immunomodulatory effects of lactoferrin.Acta Pharmacol. Sin.35557–566. 10.1038/aps.2013.200
130
SohlenkampC.GeigerO. (2016). Bacterial membrane lipids: diversity in structures and pathways.FEMS Microbiol. Rev.40133–159. 10.1093/femsre/fuv008
131
Solorzano-SantosF.Miranda-NovalesM. G. (2012). Essential oils from aromatic herbs as antimicrobial agents.Curr. Opin. Biotechnol.23136–141. 10.1016/j.copbio.2011.08.005
132
SrikanthS.BerkS. G. (1994). Adaptation of amoebae to cooling tower biocides.Microb. Ecol.27293–301. 10.1007/BF00182412
133
SteinertM.HentschelU.HackerJ. (2002). Legionella pneumophila: an aquatic microbe goes astray.FEMS Microbiol. Rev.26149–162. 10.1111/j.1574-6976.2002.tb00607.x
134
SteinertM.OckertG.LuckC.HackerJ. (1998). Regrowth of Legionella pneumophila in a heat-disinfected plumbing system.Zentralbl. Bakteriol.288331–342. 10.1016/S0934-8840(98)80005-4
135
TarikuY.HymeteA.HailuA.RohloffJ. (2011). In vitro evaluation of antileishmanial activity and toxicity of essential oils of Artemisia absinthium and Echinops kebericho.Chem. Biodivers.8614–623. 10.1002/cbdv.201000331
136
TegmarkK.MorfeldtE.ArvidsonS. (1998). Regulation of agr-dependent virulence genes in Staphylococcus aureus by RNAIII from coagulase-negative staphylococci.J. Bacteriol.1803181–3186.
137
ThomasV.BouchezT.NicolasV.RobertS.LoretJ. F.LeviY. (2004). Amoebae in domestic water systems: resistance to disinfection treatments and implication in Legionella persistence.J. Appl. Microbiol.97950–963. 10.1111/j.1365-2672.2004.02391.x
138
UlteeA.BennikM. H.MoezelaarR. (2002). The phenolic hydroxyl group of carvacrol is essential for action against the food-borne pathogen Bacillus cereus.Appl. Environ. Microbiol.681561–1568. 10.1128/AEM.68.4.1561-1568.2002
139
UlteeA.KetsE. P.SmidE. J. (1999). Mechanisms of action of carvacrol on the food-borne pathogen Bacillus cereus.Appl. Environ. Microbiol.654606–4610.
140
UlteeA.SmidE. J. (2001). Influence of carvacrol on growth and toxin production by Bacillus cereus.Int. J. Food Microbiol.64373–378. 10.1016/S0168-1605(00)00480-3
141
VerdonJ.BerjeaudJ. M.LacombeC.HechardY. (2008). Characterization of anti-Legionella activity of warnericin RK and delta-lysin I from Staphylococcus warneri.Peptides29978–984. 10.1016/j.peptides.2008.01.017
142
VerdonJ.FalgeM.MaierE.BruhnH.SteinertM.FaberC.et al (2009a). Detergent-like activity and alpha-helical structure of warnericin RK, an anti-Legionella peptide.Biophys. J.971933–1940. 10.1016/j.bpj.2009.06.053
143
VerdonJ.GirardinN.LacombeC.BerjeaudJ. M.HechardY. (2009b). delta-hemolysin, an update on a membrane-interacting peptide.Peptides30817–823. 10.1016/j.peptides.2008.12.017
144
VerdonJ.LabanowskiJ.SahrT.FerreiraT.LacombeC.BuchrieserC.et al (2011). Fatty acid composition modulates sensitivity of Legionella pneumophila to warnericin RK, an antimicrobial peptide.Biochim. Biophys. Acta18081146–1153. 10.1016/j.bbamem.2010.12.011
145
WalkerJ. T.MackernessC. W.MallonD.MakinT.WillietsT.KeevilC. W. (1995). Control of Legionella pneumophila in a hospital water system by chlorine dioxide.J. Ind. Microbiol.15384–390. 10.1007/BF01569995
146
WangH.EdwardsM.FalkinhamJ. O.IIIPrudenA. (2012). Molecular survey of the occurrence of Legionella spp., Mycobacterium spp., Pseudomonas aeruginosa, and amoeba hosts in two chloraminated drinking water distribution systems.Appl. Environ. Microbiol.786285–6294. 10.1128/AEM.01492-12
147
WeersP. M.RyanR. O. (2006). Apolipophorin III: role model apolipoprotein.Insect. Biochem. Mol. Biol.36231–240. 10.1016/j.ibmb.2006.01.001
148
WillumeitR.KumpugdeeM.FunariS. S.LohnerK.NavasB. P.BrandenburgK.et al (2005). Structural rearrangement of model membranes by the peptide antibiotic NK-2.Biochim. Biophys. Acta1669125–134. 10.1016/j.bbamem.2005.01.011
149
WingenderJ.FlemmingH. C. (2011). Biofilms in drinking water and their role as reservoir for pathogens.Int. J. Hyg. Environ. Health214417–423. 10.1016/j.ijheh.2011.05.009
150
XuH. M.RongY. J.ZhaoM. X.SongB.ChiZ. M. (2014). Antibacterial activity of the lipopetides produced by Bacillus amyloliquefaciens M1 against multidrug-resistant Vibrio spp. isolated from diseased marine animals.Appl. Microbiol. Biotechnol.98127–136. 10.1007/s00253-013-5291-1
151
XuL.LuoZ. Q. (2013). Cell biology of infection by Legionella pneumophila.Microbes Infect.15157–167. 10.1016/j.micinf.2012.11.001
152
YuV. L.PlouffeJ. F.PastorisM. C.StoutJ. E.SchousboeM.WidmerA.et al (2002). Distribution of Legionella species and serogroups isolated by culture in patients with sporadic community-acquired legionellosis: an international collaborative survey.J. Infect. Dis.186127–128. 10.1086/341087
153
Zdybicka-BarabasA.Palusinska-SzyszM.GruszeckiW. I.MakP.CytrynskaM. (2014). Galleria mellonella apolipophorin III - an apolipoprotein with anti-Legionella pneumophila activity.Biochim. Biophys. Acta18382689–2697. 10.1016/j.bbamem.2014.07.003
Summary
Keywords
Legionella pneumophila, biofilms, amoebae, biocides, natural compounds, antimicrobial peptides, essential oils, biosurfactants
Citation
Berjeaud J-M, Chevalier S, Schlusselhuber M, Portier E, Loiseau C, Aucher W, Lesouhaitier O and Verdon J (2016) Legionella pneumophila: The Paradox of a Highly Sensitive Opportunistic Waterborne Pathogen Able to Persist in the Environment. Front. Microbiol. 7:486. doi: 10.3389/fmicb.2016.00486
Received
26 January 2016
Accepted
23 March 2016
Published
08 April 2016
Volume
7 - 2016
Edited by
Charles W. Knapp, University of Strathclyde, UK
Reviewed by
Marta Palusinska-Szysz, Maria Curie-Sklodowska University, Poland; Dinesh Sriramulu, Shres Consultancy, India
Updates

Check for updates
Copyright
© 2016 Berjeaud, Chevalier, Schlusselhuber, Portier, Loiseau, Aucher, Lesouhaitier and Verdon.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Julien Verdon, julien.verdon@univ-poitiers.fr
This article was submitted to Antimicrobials, Resistance and Chemotherapy, a section of the journal Frontiers in Microbiology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.