Skip to main content

ORIGINAL RESEARCH article

Front. Cardiovasc. Med., 10 December 2021
Sec. Lipids in Cardiovascular Disease
This article is part of the Research Topic The Roles of Lipids in Immunometabolism: The crosstalk between lipid metabolisms and inflammation View all 17 articles

Hematopoietic Cell-Specific SLC37A2 Deficiency Accelerates Atherosclerosis in LDL Receptor-Deficient Mice

\nQingxia Zhao&#x;Qingxia Zhao1Zhan Wang&#x;Zhan Wang1Allison K. MeyersAllison K. Meyers2Jennifer MadenspacherJennifer Madenspacher3Manal ZabalawiManal Zabalawi1Qianyi ZhangQianyi Zhang4Elena BoudyguinaElena Boudyguina1Fang-Chi HsuFang-Chi Hsu5Charles E. McCall,Charles E. McCall1,2Cristina M. FurduiCristina M. Furdui1John S. ParksJohn S. Parks1Michael B. FesslerMichael B. Fessler3Xuewei Zhu,
Xuewei Zhu1,2*
  • 1Department of Internal Medicine, Section on Molecular Medicine, Wake Forest School of Medicine, Winston-Salem, NC, United States
  • 2Department of Microbiology and Immunology, Wake Forest School of Medicine, Winston-Salem, NC, United States
  • 3Immunity, Inflammation and Disease Laboratory, National Institute of Environmental Health Sciences, NIH, Durham, NC, United States
  • 4Department of Biology, Wake Forest University, Winston-Salem, NC, United States
  • 5Department of Biostatistics and Data Science, Wake Forest School of Medicine, Winston-Salem, NC, United States

Macrophages play a central role in the pathogenesis of atherosclerosis. Our previous study demonstrated that solute carrier family 37 member 2 (SLC37A2), an endoplasmic reticulum-anchored phosphate-linked glucose-6-phosphate transporter, negatively regulates macrophage Toll-like receptor activation by fine-tuning glycolytic reprogramming in vitro. Whether macrophage SLC37A2 impacts in vivo macrophage inflammation and atherosclerosis under hyperlipidemic conditions is unknown. We generated hematopoietic cell-specific SLC37A2 knockout and control mice in C57Bl/6 Ldlr−/− background by bone marrow transplantation. Hematopoietic cell-specific SLC37A2 deletion in Ldlr−/− mice increased plasma lipid concentrations after 12-16 wks of Western diet induction, attenuated macrophage anti-inflammatory responses, and resulted in more atherosclerosis compared to Ldlr−/− mice transplanted with wild type bone marrow. Aortic root intimal area was inversely correlated with plasma IL-10 levels, but not total cholesterol concentrations, suggesting inflammation but not plasma cholesterol was responsible for increased atherosclerosis in bone marrow SLC37A2-deficient mice. Our in vitro study demonstrated that SLC37A2 deficiency impaired IL-4-induced macrophage activation, independently of glycolysis or mitochondrial respiration. Importantly, SLC37A2 deficiency impaired apoptotic cell-induced glycolysis, subsequently attenuating IL-10 production. Our study suggests that SLC37A2 expression is required to support alternative macrophage activation in vitro and in vivo. In vivo disruption of hematopoietic SLC37A2 accelerates atherosclerosis under hyperlipidemic pro-atherogenic conditions.

Introduction

Atherosclerosis is driven by hyperlipidemia and exacerbated by chronic low-grade inflammation (16). Macrophages are among the most abundant immune cells within atherosclerotic plaques (1, 5, 710). Inside the atherosclerotic plaque, macrophages take up modified LDL (i.e., oxidized LDL; oxLDL), forming lipid laden-macrophages or foam cells, which worsen inflammation and promote atherosclerotic plaque growth (1, 5, 710). As a heterogeneous cell population, macrophages can be roughly grouped into two categories based on their inflammatory activities: classically activated pro-inflammatory (M1) macrophages and alternatively activated anti-inflammatory macrophages (11). The anti-inflammatory (M2) macrophages can be subdivided into M2a, 2b, 2c, and 2d based on the stimuli and resultant transcriptional changes (11). These in vitro models of macrophage polarization (M1 vs. M2) are more simplified than the microenvironment that macrophages encounter in an atherosclerotic lesion (12). Nevertheless, mounting evidence suggests that macrophage plasticity or phenotypic switch impacts atherosclerotic lesion progression and regression (1, 13, 14). Uncovering the underlying mechanisms governing activation and deactivation of macrophages and their phenotypic switch provides a promising avenue to prevent and treat atherosclerosis.

Macrophages rewire intracellular metabolic pathways upon activation, which in turn modify their cellular function (1517). Pro-inflammatory macrophages, such as lipopolysaccharide (LPS)-stimulated macrophages [M (LPS)], requires glycolysis to mount an effective inflammatory response. However, whether glycolytic reprogramming is necessary for alternative macrophage activation is still debatable and requires further investigation. Moreover, little is known about how and to what extent macrophages reprogram cellular metabolism in response to microenvironmental stimuli to promote or resolve inflammation under pro-atherogenic conditions. A positive association between glycolysis and plaque macrophage inflammation was documented as increased glucose metabolic activity in human symptomatic and unstable plaque macrophages compared with asymptomatic lesions (18). However, macrophage glycolytic rate does not always influence atherogenesis, at least based on animal studies. For example, myeloid deletion of glucose transporter 1 (GLUT1), the primary glucose transporter on the plasma membrane in macrophages, does not alter atherosclerotic plaque size or macrophage content in Ldlr−/− mice (19). Moreover, myeloid overexpression of GLUT1 increases glucose flux in macrophages and enhances macrophage inflammation in vitro but is insufficient to promote atherosclerosis (20). These findings suggest a context-dependent regulation of macrophage inflammation and disease development by cellular metabolic processes in acute vs. chronic low-grade inflammation.

Solute carrier family 37 member 2 (SLC37A2), an endoplasmic reticulum-anchored phosphate-linked glucose-6-phosphate transporter, is highly expressed in macrophages (2123). We have recently reported that SLC37A2 plays a pivotal role in murine macrophage inflammatory activation and cellular metabolic rewiring (24). SLC37A2 deletion reprograms macrophages to a hyper-glycolytic state of energy metabolism and accelerates M (LPS) activation, partially depending on nicotinamide adenine dinucleotide (NAD+) biosynthesis. Blockade of glycolysis or the NAD+ salvage pathway normalizes the differential expression of pro-inflammatory cytokines between control and SLC37A2-deficient macrophages. Conversely, overexpression of SLC37A2 lowers macrophage glycolysis and significantly reduces LPS-induced pro-inflammatory cytokine expression. Our published work suggests that SLC37A2 is a negative regulator of murine macrophage pro-inflammatory activation by down-regulating glycolytic reprogramming.

Despite these findings, it remains unclear whether macrophage SLC37A2 impacts macrophage pro- or anti-inflammatory activation in vivo under pathologic conditions. Further, it is not known whether macrophage SLC37A2-mediated inflammation affects the pathogenesis of inflammatory diseases. Here, we found that SLC37A2 expression is necessary to maintain alternative macrophage activation in vitro. Our data suggest that SLC37A2 positively regulates IL-4-induced macrophage alternative activation, independent of glycolysis or mitochondrial respiration. SLC37A2 positively regulates apoptotic cell-induced macrophage alternative activation through modulation of glycolysis. Lastly, we found that disruption of hematopoietic SLC37A2 expression impairs anti-inflammatory responses and worsens hyperlipidemia-induced atherosclerosis in Ldlr−/− mice.

Materials and Methods

Animals, Bone Marrow Transplantation, and Diet Feeding

Animals

Slc37a2 global knockout mice in the C57BL/6J background (T1837) were purchased from Deltagen, Inc (24). Heterozygous Slc37a2 knockout mice were intercrossed to obtain wild type (WT) and homozygous knockout (Slc37a2−/−) mice. Ldlr−/− (stock 002207) mice were purchased from Jackson Laboratories. Mice were housed in a pathogen-free facility on a 12 h light/dark cycle and received a standard laboratory diet.

BMT

7 × 106 BM cells from female donor (WT and Slc37a2−/−) mice were injected into the retro-orbital venous plexus of irradiated male Ldlr–/- recipient mice. Repopulation of blood leukocytes after BMT was evaluated after 16 wks of diet feeding by determining the percentage expression of the Y-chromosome-associated sex-determining region Y gene (Sry) in genomic DNA obtained from white blood cells, as described previously (25).

High-Fat Western Diet Feeding

After 5 wks of recovery from radiation, mice were switched from a standard laboratory diet to a high-fat WD containing 42% calories from fat and 0.2% cholesterol (TD. 88137, Teklad) for an additional 16 wks to induce advanced atherosclerosis.

All animal experimental protocols were approved by the Wake Forest University Animal Care and Use Committee.

Analysis of Atherosclerotic Lesions

Aortic root atherosclerosis was assessed as described before (25). Briefly, aortic root sections were stained in 0.5% Oil Red O and counterstained with hematoxylin. To measure necrosis, we drew boundary lines using NIH ImageJ software around regions free of H&E staining. We used a 3,000 μm2 threshold to avoid counting regions that may not represent substantial areas of necrosis, as described before (25). Stained sections were photographed with an Olympus DP71 digital camera and quantified using NIH ImageJ software. Results were expressed as cross-sectional plaque area (H&E) or plaque necrosis (necrotic core), or percent of total plaque area or necrosis core. Macrophages and T cells in aortic root were stained by incubating aortic root cross-sections with the primary antibodies to CD68 (Bio-Rad) and CD3 (Abcam), followed by the biotinylated secondary antibody. The staining was visualized using the ABC reagent (ABC vector kit; Vector) and DAB substrate chromogen (Dako). Apoptotic cells in atherosclerotic lesions were stained using the Click-iT Plus TUNEL Assay kit (Thermo Fisher) according to the manufacturer's protocol. The sections were then stained with CD68 antibody (Bio-Rad), and nuclei were stained with DAPI. Only TUNEL-positive cells that co-localized with DAPI-positive nuclei were counted as apoptotic cells. Efferocytosis was determined by counting the number of macrophage-associated vs. free apoptotic cells, following established methods published before (2529). Aortic root cross-sections were also stained with Masson's Trichrome stain to quantify collagen deposition. Areas stained blue within lesions were identified as collagen-positive using NIH ImageJ software.

Cell Culture and Treatment

Peritoneal Macrophage Culture

Peritoneal cells were harvested from mice after a 16-wk diet feeding (30, 31). Cells were plated in RPMI-1640 media containing 100 U/ml penicillin and 100 μg/ml streptomycin. After a 2 h incubation, floating cells were removed by washing with PBS, and adherent macrophages were lysed using Trizol (Invitrogen) for RNA extraction.

BMDM Culture

Mouse bone marrow was cultured in low glucose DMEM supplemented with 30% L929 cell-conditioned medium and 20% FBS for 6-7 days until the cells reached confluence. BMDMs were then reseeded in culture dishes overnight in RPMI 1640 medium containing 1% Nutridoma-SP medium (Sigma-Aldrich) before any treatment (24).

Jurkat T Cell Culture

Jurkat T cells (TIB-152, ATCC) were maintained in 10% FBS containing RPMI-1640 medium. Jurkat T cells (2 × 106/ml) were treated with 1 μM staurosporine in RPMI-1640 media containing 100 U/ml penicillin and 100 μg/ml streptomycin for 4 h to induce apoptosis.

Macrophage Stimulation

BMDMs were incubated with 20 ng/ml IL-4 or ACs (ratio of ACs to macrophages was 5:1) in 10% FBS containing for indicated times as written in the figure legends. To induce foam cell formation, BMDMs were treated with 25 or 50 μg/ml oxLDL (Athens Research & Technology) for 0-24 h. In some experiments, BMDMs were pretreated for 30 min with hexokinase inhibitor 2-deoxy-D-glucose (2-DG; 10 mM, Sigma-Aldrich), actin polymerization inhibitor cytochalasin D (10 μM, Cayman), or fatty acid β-oxidation inhibitor etomoxir (50 μM, Cayman) and subsequently treated with apoptotic cells for an additional 4 h in the presence of each inhibitor.

Cytokine Quantification

Total RNA in tissues or macrophages was extracted using Trizol (Invitrogen). cDNA preparation and real-time PCR were conducted as described previously (24, 25). Primers are listed in Supplementary Table S1. Concentrations of cytokines/chemokines in plasma, liver homogenate, or cell culture supernatant were measured using Bioplex assay or ELISA according to the manufacturer's instructions.

Flow Cytometry

Peripheral blood and splenocytes were stained with Gr1(Ly6C/G)-PerCP-Cy5.5 (BD Pharmingen, cat# 552093), CD115-APC (eBioscience, cat# 17-1152-82), CD11b-APC Cy7 (BD Bioscience, cat# 557657), and V450-CD45 (BD Horizon, cat# 560501) (30). Data were acquired on a BD FACS Canto II instrument (BD Biosciences) and analyzed using FACSDiva software v6.1.3 (BD Biosciences).

To examine the apoptotic rate, Jurkat T cells were stained with Annexin V-APC and PI (Thermo Fisher). To examine efferocytosis, Jurkat T cells were first stained with cell tracker green CMFDA (2 μM) at 37°C for 30 min before treated with 1 μM staurosporine for 4 h to induce apoptosis. Fluorescent labeled apoptotic Jurkat T cells were then incubated with macrophages at 37°C for 0-120 min. Macrophages were then washed with PBS for five times and incubated with accutase dissociation buffer at 37°C for 30 min. Data were acquired on a BD FACSCalibur (BD Biosciences) and analyzed using Flowjo V7.6.5 (BD Biosciences).

Glucose Tolerance Tests and Insulin Tolerance Tests

Mice were fasted overnight before intraperitoneal injection of 1 g glucose/kg body weight (BW). One wk later, the same groups of mice were used for intraperitoneal injection of 0.75 U of regular human insulin/kg BW after a 4 h fast. Blood glucose concentrations were measured at 0, 15, 30, 60, and 120 min after each injection using a Bayer Contour glucose meter kit (31).

Immunofluorescent Staining of Liver Tissues

Frozen sections of liver tissues were incubated with the primary antibodies to CD68 (Bio-Rad, 1:100 dilution) and CD206 (Cell Signaling, 1:400 dilution), followed by FITC goat anti-rat IgG (Vector, 1:200) and TexasRed conjugated goat anti-rabbit IgG (Vector, 1:200). Sections were imaged with a digital camera mounted on a fluorescent microscope (Olympus DP71), and analyzed by using ImageJ (NIH). Analysis was performed on 8 of 40 × fields/section to calculate the mean count of positively stained cells per mm2.

Lipid Analysis

4 h-fasting plasma total cholesterol (TC), free cholesterol (FC) (Wako), and triglyceride (TG) (Roche) were determined by enzymatic analysis. Plasma was fractionated by FPLC to determine cholesterol distribution among the lipoprotein classes (32). Liver lipids were extracted with chloroform: methanol (2:1), and the extract was used for enzymatic assays (33) (cholesterol, Wako; TG, Roche), and lipids were normalized to wet liver weight. Macrophage cholesterol content was measured by gas-liquid chromatography (34) and normalized to cellular protein (34).

Seahorse Assay

2 × 105 BMDMs were plated into each well of Seahorse XF96 cell culture microplates (Agilent Technologies) and cultured overnight before treated with or without 20 ng/ml IL-4 for 6 or 24 h or ACs for 3 h. Basal and IL-4- or AC-induced changes in oxygen consumption rate (OCR) were measured with a Seahorse XF96 Extracellular Flux Analyzer (Agilent Technologies) using a Seahorse mito stress test kit. Extracellular acidification rate (ECAR) in BMDMs was recorded using a glycolysis stress test kit (Agilent Technologies). OCR and ECAR were measured under basal conditions and following the sequential addition of 10 mM glucose, 1 μM oligomycin, 1.5 μM fluoro-carbonyl cyanide phenylhydrazone (FCCP), 100 nM rotenone plus 1 μM antimycin A, or 50 mM 2DG (all the compounds were from Agilent Technologies), as described in the figure legends. After the assay, 3 μM Hoechst (Life Technologies) was added to each well to stain nuclei for cell counting. Results were collected with Wave software version 2.6 (Agilent Technologies). Data were normalized to cell numbers.

Western Blotting

BMDM protein concentration was measured using the BCA protein assay kit (Pierce). Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 (24). β-actin (Sigma-Aldrich, no. A5441; 1:5,000) was used as a loading control. Blots were developed using HRP-linked secondary antibodies. Immunoblots were visualized with the Supersignal substrate system (Pierce). Chemiluminescence was captured using the ChemiDox MP imaging system (Bio-Rad) or an LSA-3000 imaging system (Fujifilm Life Science). The experiments were repeated at least two times.

Statistics

Statistical analysis was performed using GraphPad Prism software 7 (GraphPad Software) except for the plasma lipid analysis in Figures 1A–D. Data are presented as the mean ± SEM unless indicated otherwise. Differences were compared with Student's t-test or two-way ANOVA with post hoc Tukey's multiple comparison test as indicated in the figure legends. In Figures 1A–D, the mixed-effects models were used to compare lipids variables between genotype groups at each time point. The use of random intercepts provided a source of autocorrelation between repeated measures. Genotype groups and weeks and the interaction between genotype groups and weeks were included in the model. Contrasts were used to compare lipid variables at each measured week. P < 0.05 was considered statistically significant.

FIGURE 1
www.frontiersin.org

Figure 1. Hematopoietic cell-specific SLC37A2 deletion increases plasma lipids in WD-fed Ldlr−/− mice. Hematopoietic SLC37A2 knockout (SLC37A2Δhema) and control (WTΔhema) Ldlr−/− mice were switched from a standard laboratory diet to high-fat WD for 16 wks to promote the development of advanced atherosclerosis. (A–D) Fasting (4 h) plasma total cholesterol (TC), free cholesterol (FC), cholesterol ester (CE), and triglyceride (TG) concentrations were measured by enzymatic assays over time (0-16 wks) (n = 12-16). (E) Plasma cholesterol distribution among lipoproteins after 16 wks of WD feeding was determined after fractionation of plasma by fast protein liquid chromatography (n = 6-8). Data are expressed as mean ± SEM. *P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001. The mixed-effects models were used to compare lipids variables between genotype groups at each time point. HDL indicates high-density lipoprotein; LDL, low-density lipoprotein; and VLDL, very-low-density lipoprotein.

Results

Hematopoietic Cell-Specific SLC37A2 Deletion Increases Plasma Lipids in WD-Fed Ldlr–/- Mice

We previously showed that SLC372 is a novel regulator of macrophage inflammation by controlling glycolysis (24). In this study, we wanted to know whether mice lacking SLC37A2 in macrophages were at an increased risk of developing atherosclerosis. To do this, we generated hematopoietic SLC37A2 knockout (SLC37A2Δhema) mice in Ldlr−/− background by BMT. The BMT efficiency was ~90% based on the male Sry gene expression in blood leukocytes isolated from recipient mice examined after 16-wk diet feeding (Supplementary Figures S1A,B). Four wks of WD feeding increased plasma lipid (including plasma TC, FC, CE, and TG) concentrations in both genotypes. Interestingly, SLC37A2Δhema mice displayed significantly higher plasma cholesterol concentrations after 12 and 16 wks of diet feeding (Figures 1A–C). SLC37A2Δhema mice also showed significantly higher plasma TG concentration after 16 wks of diet feeding (Figure 1D). Furthermore, we observed significantly higher plasma VLDL and LDL cholesterol concentrations but only a marginal increase in HDL cholesterol in SLC37A2Δhema vs. WT mice after 16 wks of diet feeding (Figure 1E). Collectively, these results suggest a novel role for hematopoietic SLC37A2 in lipid metabolism under pro-atherogenic conditions.

Hematopoietic Cell-Specific SLC37A2 Deletion Increases Liver CE and Reduces Hepatic Macrophage Activation in WD-Fed Ldlr–/- Mice

Given the increased plasma lipid concentrations in high-fat WD-fed SLC37A2Δhema mice, we next measured liver lipid concentrations. Consistent with increased plasma lipid concentrations, we observed a significant increase in hepatic TC and CE, but not FC or TG in SLC37A2Δhema vs. WT mice (Figure 2A). The increased plasma and liver lipid concentrations in SLC37A2Δhema mice prompted us to examine the hepatic expression of genes involved in lipid metabolism in diet-fed mice. As expected, Slc37a2 transcript was significantly lower in SLC37A2Δhema mice receiving bone marrow from Slc37a2−/− mice (Figure 2B). We found that hepatic expression of genes responsible for de novo lipogenesis was similar between genotypes of mice (Figure 2C). However, SLC37A2Δhema liver showed decreased expression of cholesterol transporter proteins ABCA1 and SR-BI but increased expression of oxidized LDL receptor-1 (OLR1), indicating impaired cholesterol efflux but enhanced cholesterol uptake (Figure 2C). Furthermore, hepatic expression of the receptor for fatty acid uptake (CD36), enzymes for fatty acid oxidation (Cpt1a, Acox1, Acadl), and transcriptional factors and coactivators regulating fatty acid oxidation (PGC1α, PGC1β, PPARδ, and PPARγ) were all down-regulated in SLC37A2Δhema vs. WT liver (Figure 2D), suggesting an impaired fatty acid utilization in SLC37A2Δhema mouse liver at least at the transcriptional level.

FIGURE 2
www.frontiersin.org

Figure 2. Hematopoietic cell-specific SLC37A2 deletion increases liver cholesterol ester and reduces hepatic macrophage activation in WD-fed LDLrKO mice. Irradiated Ldlr−/− mice transplanted with WT or SLC37A2KO bone marrow were fed a high-fat western diet for 16 wks. (A) Fasting (4 h) total cholesterol (TC), free cholesterol (FC), cholesterol ester (CE), and triglyceride (TG) concentrations in the liver were measured by enzymatic assays (n = 12 per genotype). (B) Slc37a2 transcript expression in liver (n = 12 per genotype). (C) Relative transcript levels for cholesterol efflux, cholesterol uptake, cholesterol synthesis, fatty acid synthesis, and transcriptional regulators controlling these pathways in the liver (n = 12 per genotype). (D) Relative transcript levels for genes encoding key enzymes in fatty acid uptake, β-oxidation, and transcriptional regulators controlling these pathways in the liver (n = 12 per genotype). (E) Relative transcript levels for genes encoding macrophage markers in the liver (n = 12 per genotype). (F,G) Liver cytokine and chemokine protein concentrations (n = 12 per genotype). (H) Relative transcript levels for genes encoding macrophage anti-inflammatory markers in the liver (n = 12 per genotype). (I) Liver IL-10 protein concentrations (n = 12 per genotype). (J) Representative images of CD68 and CD206 double-stained liver tissues. White and red arrowheads indicate representative CD68+CD206+ and CD68+CD206 cells, respectively. Scale bar = 100 μm. (K) Quantification of CD68+CD206+ cell number in liver tissue (n = 12 per genotype). (L) Quantification of CD68+ cell number in liver tissue (n = 12 per genotype). Data are expressed as mean ± SEM. *P < 0.05, **P < 0.01, ***P < 0.01, ***P < 0.001, ****P < 0.0001, unpaired, two-tailed Student's t-test.

Because macrophage pro-inflammation impairs reverse cholesterol transport at multiple steps (35) and alternative activation of hepatic macrophages promotes liver fatty acid oxidation and improves metabolic syndrome (36), we next examined macrophage pro- and anti-inflammatory states by measuring hepatic gene expression of macrophage markers, M1-type cytokines, and chemokines, and M2 macrophage markers. Different from our in vitro study, in which we observed increased pro-inflammatory cytokine production in SLC37A2Δhema macrophages in response to TLR activation (24), under pro-atherogenic conditions, hematopoietic SLC37A2 deficiency has a minor effect on the expression of genes encoding macrophage markers (Figure 2E) and the protein level of pro-inflammatory cytokines and chemokines (Figures 2F,G). Rather, we observed a slightly decreased IFN-γ and MCP-1 (Figures 2F,G) protein concentration in SLC37A2Δhema liver, suggesting that SLC37A2 deletion in bone marrow is not sufficient to induce a pro-inflammatory response in the liver under pro-atherogenic conditions. Despite the equivalent or slightly decreased pro-inflammatory cytokines/chemokines in SLC37A2Δhema liver, hepatic anti-inflammatory markers, including arginase 1 (Arg1), mannose receptor C-type 1 (Mrc1, also known as CD206), Ym1, and IL-10, showed significantly lower expression in SLC37A2Δhema vs. WT liver (Figure 2H). Consistent with the decreased transcript expression, hepatic IL-10 protein concentration showed a trend toward a decrease in SLC37A2Δhema liver, relative to control (Figure 2I). Moreover, the number of CD68+CD206+ positive cells (alternatively activated macrophages) were significantly lower in SLC37A2Δhema liver than WT (Figures 2J,K). However, the number of CD68+ cells was comparable between genotypes (Figures 2J,L). Taken together, our results suggest that genetic deletion of SLC37A2 in bone marrow cells significantly impairs alternative activation of hepatic macrophages, associated with lower hepatic fatty acid oxidation, lower cholesterol efflux, but increased cholesterol uptake, gene expression and increased liver lipid accumulation.

Hematopoietic Cell-Specific SLC37A2 Deletion Primarily Impairs Anti-inflammatory Responses in WD-Fed Ldlr–/- Mice

To determine whether hematopoietic SLC37A2 deletion affects inflammation at the systemic level, we first examined plasma concentrations of pro-inflammatory cytokines, chemokines, and anti-inflammatory cytokine using a multiplex assay. Consistent with the expression pattern of hepatic cytokines and chemokines, plasma pro-inflammatory cytokine concentrations did not differ between genotypes (Figure 3A). But, plasma MCP-1 concentration showed a 28.6% reduction in the SLC37A2Δhema vs. WT mice (Figure 3B). Strikingly, the SLC37A2Δhema mice displayed a 70% reduction of the anti-inflammatory cytokine IL-10 in plasma (Figure 3C) relative to their WT counterparts, suggesting hematopoietic SLC37A2 deletion impairs IL-10 production under pro-atherogenic conditions.

FIGURE 3
www.frontiersin.org

Figure 3. Hematopoietic cell-specific SLC37A2 deletion primarily impairs anti-inflammatory responses in WD-fed Ldlr−/− mice. Hematopoietic SLC37A2 knockout (SLC37A2Δhema) and control (WTΔhema) Ldlr−/− mice were fed a high-fat western diet for 16 wks. (A–C) Plasma pro-inflammatory cytokine (A), chemokine (B), and anti-inflammatory cytokine IL-10 (C) concentrations were quantified by multiplex assay. (D–F) Relative transcript levels of Slc37a2, pro- and anti-inflammatory markers in resident peritoneal macrophages. Each symbol represents an individual mouse. Data are expressed as mean ± SEM. *p < 0.05; ***p < 0.001, unpaired, two-tailed Student's t-test.

We next examined inflammatory cytokine expression in resident peritoneal macrophages isolated from the diet-fed mice. As expected, SLC37A2Δhema macrophages showed more than 90% reduction in transcript expression of Slc37a2, relative to WT (Figure 3D). Despite the indistinguishable expression of pro-inflammatory cytokines (Figure 3E), SLC37A2Δhema vs. WT mice showed significantly attenuated Arg1 and Mrc1 expression in resident peritoneal macrophages (Figure 3F) after 16-wk diet feeding. Not surprisingly, SLC37A2 deletion has little impact on the gene expression of enzymes involved in fatty acid oxidation (Supplementary Figure S2A) or cholesterol metabolism (Supplementary Figure S2B) in macrophages. Together, our results suggest that hematopoietic SLC37A2 deletion primarily impairs anti-inflammatory responses in Ldlr−/− mice when challenged with the WD diet.

Hematopoietic Cell-Specific SLC37A2 Deletion Has a Minor Effect on Blood Myeloid Cell Composition in WD-Fed Ldlr–/- Mice

We next assessed whether hematopoietic SLC37A2 deletion affects monocyte and neutrophil composition in blood as well as in the spleen. Supplementary Figure S3A shows our flow cytometry gating strategies. At 9-wk WD feeding, no difference was observed between genotypes regarding the frequency of blood monocytes (CD11b+CD115+), Gr1low monocytes (CD11b+CD115+Gr1low), Gr1high monocytes (CD11b+CD115+ Gr1high), or neutrophils (CD11b+CD115Gr1+) (Supplementary Figure S3B), or the ratio of Gr1low and Gr1high monocytes in blood monocytes (Supplementary Figure S3C). After 16 wks of diet feeding, the percentage of blood neutrophils (CD11b+CD115Gr1+) was significantly increased in the SLC37A2Δhema mice (Supplementary Figure S3D). Despite the elevated plasma cholesterol and increased blood neutrophils, no difference was detected between genotypes in blood monocyte composition at 16-wk diet feeding (Supplementary Figures S3D,E). We did not observe any significant changes in the monocyte and neutrophil composition in the spleen between genotypes (Supplementary Figures S3F,G). Overall, these results suggest that hematopoietic SLC37A2 deletion has a minimal effect on blood myeloid cell composition. Note that the concentration of plasma MCP-1, a primary chemokine recruiting monocytes and macrophages from bone marrow to circulation or blood circulation to tissues, was significantly lower in the SLC37A2Δhema mice (Figure 3B). We reason that the unaltered blood and spleen monocytes may be the net effect of the combination of decreased plasma MCP-1 and increased plasma cholesterol in the SLC37A2Δhema mice. Taken together, our results suggest that hematopoietic SLC37A2 deletion has a minor effect on blood myeloid composition except for a slight increase in blood neutrophils after 16-wk WD feeding.

Hematopoietic Cell-Specific SLC37A2 Deficiency Promotes Atherosclerosis in WD-Fed Ldlr–/- Mice

Abnormal lipid metabolism and enhanced local and systemic inflammation accelerate atherosclerosis. Since we observed increased plasma lipids, especially apoB containing lipoproteins, and decreased IL-10 in plasma, we next investigated the development of atherosclerosis in SLC37A2Δhema mice compared to controls. We found that hematopoietic SLC37A2-deficient mice showed a 51% increase in aortic root lesions stained with Oil Red O (Figures 4A,B), despite similar CD68 (macrophage marker) (Figures 4C,D), suggesting that hematopoietic SLC37A2 deletion accelerates atherosclerotic plaque formation but has no effect on macrophage content. Hematopoietic SLC37A2 deletion also did not affect T cell content in the plaque, as shown by similar CD3 (T cell marker) staining between genotypes (Supplementary Figure S4). We then assessed whether there is an association between plasma lipids vs. atherosclerosis or between plasma IL-10 vs. atherosclerosis in diet-fed mice by performing linear regression analysis. Despite no significant association between intimal area and plasma TC (Figure 4E), there was a significant inverse correlation between plasma IL-10 and intimal area (Figure 4F), suggesting that the attenuated anti-inflammatory response in the SLC37A2Δhema mice may be the primary driver of enhanced atherosclerosis in those mice.

FIGURE 4
www.frontiersin.org

Figure 4. Hematopoietic cell-specific SLC37A2 deficiency promotes atherosclerosis in WD-fed Ldlr−/− mice. Hematopoietic SLC37A2 knockout (SLC37A2Δhema) and control (WTΔhema) Ldlr−/− mice were fed a high-fat western diet for 16 wks (n = 12-16 mice per genotype). (A,B) Quantification of Oil Red O positive intimal area in the aortic root. (C,D) Quantification of CD68+ cells (macrophages) in the aortic root intimal area. (E) Linear regression analysis of aortic root intimal area vs. plasma total cholesterol of 16-wk diet-fed mice. Each point represents an individual animal of the denoted diet group and the correlation coefficient is shown for the entire data set. (F) Linear regression analysis of aortic root intimal area vs. plasma IL-10 of 16-wk diet-fed mice. Each point represents an individual animal of the denoted diet group and the correlation coefficient is shown for the entire data set. (G,H) Quantification of the aortic necrotic intimal area (total necrotic area) in H&E stained aortic root sections. White dash line circled lesion areas. White stars indicate the necrotic area in the plaques. (I,J) Quantification of apoptosis (TUNEL-positive cells) and efferocytosis (the ratio of macrophage-associated: free apoptotic cells) in aortic root sections. CD68 (green; macrophages), TUNEL (red), and DAPI (blue; nuclei) were labeled fluorescently. (K,L) Quantification of aortic Trichrome stain positive cells. White dash line circled lesion areas. Scale bars = 100 μm. Each symbol represents an individual mouse. Data are expressed as mean ± SEM. n = 12-16 mice per group. *p < 0.05; **p < 0.01; ***p < 0.001.

IL-10 producing macrophages is responsible for the engulfment and clearance of apoptotic cells (i.e., efferocytosis) (37). Failure of efferocytosis leads to pro-inflammatory and immunogenic consequences due to secondary necrosis, exaggerating atherosclerosis (38, 39). We next examined the necrotic core formation and quantified apoptosis and efferocytosis in the plaques. Compared to WT control, SLC37A2Δhema mice had a significant increase (~40%) in the necrotic area in aortic lesions (Figures 4G,H). However, no difference was observed regarding the frequency of apoptosis or efferocytosis in lesions between genotypes at 16 wks of diet feeding (Figures 4I,J). Interestingly, when we stained the aortic root sections with Masson's Trichrome stain, we observed a 30% reduction in Trichrome positive staining in SLC37A2Δhema vs. WT control aortic root sections (Figures 4K,L), suggesting that hematopoietic SLC37A2 deficiency decreases collagen deposition, likely resulting from impaired alternative macrophage activation. As collagen formation is associated with the stability of plaques (40, 41), our data suggest that SLC37A2 deficiency in bone marrow promotes plaque instability. Together, our results indicate that hematopoietic SLC37A2 deletion worsens atherosclerosis, inversely associated with plasma IL-10 levels.

Hematopoietic Cell-Specific SLC37A2 Deletion Has Minimal Impact on Insulin Resistance and Adipose Inflammation Under Pro-atherogenic Conditions

In addition to atherosclerosis assessment, we also tested whether hematopoietic cell-specific SLC37A2 deletion influences adipose tissue inflammation and/or obesity and insulin resistance under pro-atherogenic conditions. WT and SLC37A2Δhema mice gained similar body weight over the 16 wks of diet feeding (Supplementary Figure S5A). Tissue (including liver, spleen, and epididymal fat) mass was comparable between genotypes (Supplementary Figure S5B). Both genotypic mice showed similar glucose clearance and insulin tolerance around 10-11 wks of diet feeding (Supplementary Figures S5C,D). As expected, Slc37a2 mRNA expression was significantly reduced in the SLC37A2Δhema vs. control mouse epididymal fat. However, hematopoietic deletion of SLC37A2 did not alter adipose tissue inflammation, as quantified by qPCR analysis of gene expression of macrophage pro- and anti-inflammatory markers, except for increasing ccr2 (MCP-1 receptor) expression (Supplementary Figure S5E). These results suggest that deletion of SLC37A2 in bone marrow cells has minimal impact on WD-induced obesity, insulin resistance, and adipose tissue inflammation under pro-atherosclerotic conditions.

SLC37A2 Deficiency Promotes OxLDL-Induced Macrophage Inflammation

OxLDL promotes foam cell formation and triggers oxidative stress and pro-inflammatory responses in macrophages (42, 43), contributing to atherosclerotic plaque formation. Given that there was no significant increase in pro-inflammatory responses in SLC37A2Δhema vs. control mice after 16-wk WD feeding, we asked whether SLC37A2 deletion can affect oxLDL-induced macrophage inflammation in vitro. We found that oxLDL markedly increased SLC37A2 protein expression in BMDMs after 24 h stimulation (Figure 5A). OxLDL promoted cholesterol, particularly CE, accumulation in macrophages in a dose-dependent manner (Figure 5B), regardless of genotypes. However, SLC37A2 deletion does not affect cholesterol loading in macrophages (Figure 5B), suggesting a dispensible role for SLC37A2 in macrophage foam cell formation. Like LPS-stimulated cells, Slc37a2−/− macrophages showed increased expression of Il-1β and Il-6, but not Tnf at the transcriptional level in response to 24 h of oxLDL stimulation (Figure 5C), suggesting that SLC37A2 is a stress-responsive protein and increased SLC37A2 expression likely serves as a protective mechanism for resolution of stress-induced inflammation.

FIGURE 5
www.frontiersin.org

Figure 5. SLC37A2 deficiency promotes oxidized LDL (OxLDL)-induced macrophage inflammation in vitro. (A) SLC37A2 protein expression analyzed by Western blotting in WT and Slc37a2−/− bone marrow-derived macrophages (BMDMs) treated with 50 μg/ml oxLDL for 0-24 h. (B) Quantification of cellar total cholesterol (TC), free cholesterol (FC), and cholesterol ester (CE) in WT and Slc37a2−/− BMDMs after treated with or without 25 or 50 μg/ml oxLDL for 24 h. (C) Relative transcript level of cytokines in WT and Slc37a2−/− BMDMs stimulated with 50 μg/ml oxLDL for 0-24 h, measured by qPCR. Data are representative of two independent experiments with three samples per group (mean ± SEM). *p < 0.05; unpaired, two-tailed Student's t-test.

SLC37A2 Deficiency Impairs IL-4-Induced Macrophage Activation

IL-4 signaling activates STAT6, inducing the expression of genes involved in fatty acid metabolism and transcriptional regulation (such as transcriptional factors PPARs and PPARγ coactivator PGC1β) for reprogramming macrophage lipid metabolism (44). We found that IL-4 induced a 1.5-fold increase of Slc37a2 transcript at 6 h (Figure 6A) and a two-fold increase of SLC37A2 protein at 24 h of stimulation (Figure 6B) in WT macrophages. Consistent with our in vivo findings, SLC37A2-deficient macrophages showed decreased expression of M2 markers, including Arg1, Mrc1, and Ym1 (Figure 6C), in response to IL-4 stimulation suggesting that SLC37A2 expression is necessary for IL-4-induced macrophage [M (IL-4)] polarization. Interestingly, SLC37A2 deletion also lowered MCP-1 expression in macrophages, consistent with the lower in vivo MCP-1 expression in diet-fed SLC37A2Δhema vs. control mice. However, IL-4 does not induce IL-10 expression in either genotypic macrophages, suggesting that M (IL-4) is not a major source of IL-10 in macrophages. Note that WT and SLC37A2 deficient macrophages displayed similar expression levels of metabolic regulators (Figure 6D) and fatty acid oxidation genes (Figure 6E), which are primarily regulated by STAT6 signaling, suggesting that SLC37A2 deficiency does not impair the STAT6 signaling. Together, our data suggest that SLC37A2 deficiency impairs M (IL-4) polarization, independent of PPARs and PGC1 expression.

FIGURE 6
www.frontiersin.org

Figure 6. SLC37A2 deficiency impairs IL-4-induced macrophage activation in vitro. (A,B) SLC37A2 expression in WT and Slc37a2−/− bone marrow-derived macrophages (BMDMs) stimulated with 20 ng/ml IL-4 for 0-24 h. (A) relative transcript expression and (B) protein expression of SLC37A2 measured by qPCR and western blotting, respectively. (C) Relative transcript level of macrophage alternative activation markers, including arginase−1 (Arg), mannose receptor, type I (Mrc1), Ym1, IL-10, and chemokine MCP-1, in WT and Slc37a2−/− BMDMs stimulated with 20 ng/ml IL-4 for 0-24 h. (D,E) The relative transcript level of PPARs and genes encoding transporters or enzymes involved in fatty acid uptake or β-oxidation in WT and Slc37a2−/− BMDMs stimulated with 20 ng/ml IL-4 for 0-24 h. (F,G) Seahorse analysis of oxygen consumption rate (OCR) in WT and Slc37a2−/− BMDMs treated with or without 20 ng/ml IL-4 for 24 h. (H,I) Seahorse analysis of extracellular acidification rates (ECAR) in WT and Slc37a2−/− BMDMs treated with or without 20 ng/ml IL-4 for 24 h. Data are representative of two independent experiments with three samples per group (mean ± SEM). *p < 0.05; **p < 0.01; unpaired, two-tailed Student's t-test (A,C,D,E). Bars with different letters denote significant among groups (p < 0.05); two-way ANOVA with post hoc Tukey's multiple comparisons test (G,I).

Given that mitochondrial oxidative phosphorylation (OXPHOS) supports M (IL-4) macrophage activation (45), we next examined mitochondrial respiration by measuring OCR in BMDMs treated with or without 20 ng/ml IL-4 for 6 or 24 h. As expected, 24 h IL-4 stimulation promoted mitochondrial OXPHOS in WT macrophages, as shown by increased maximal OCR and spare respiratory capacity (Figures 6F,G). Interestingly, Slc37a2−/− vs. WT BMDMs displayed significantly higher basal respiration after 24 h of IL-4 stimulation. However, no genotypic difference was observed in maximal respiration or spare respiratory capacity in IL-4 treated cells, suggesting a minor impact of SLC37A2 deletion on mitochondrial OXPHOS in M (IL-4) macrophages (Figures 6F,G). Additionally, SLC37A2 deletion has no effect on mitochondrial respiration in 6 h IL-4 treated macrophages (Supplementary Figure S6). Evidence suggests that glycolysis and glucose utilization are required for M (IL-4) macrophage activation (45), while another study indicates that glycolysis is dispensible as long as mitochondrial OXPHOS is intact (46). Nevertheless, SLC37A2-deficient macrophages showed slightly increased glycolytic capacity at baseline. No difference in glycolysis or glycolytic capacity was observed between genotypes after IL-4 treatment (Figures 6H,I). Overall, our results suggest that SLC37A2 deletion does not significantly impact glycolysis or mitochondrial OXPHOS in M (IL-4) macrophage. Thus, the attenuated M (IL-4) activation in SLC37A2-deficient macrophages is likely independent of these two cellular metabolic processes.

SLC37A2 Deficiency Impairs Apoptotic Cell-Induced Macrophage Activation

One of the striking changes in the diet-fed SLC37A2Δhema vs. control mice is the 70% reduction of plasma IL-10, a major anti-inflammatory cytokine for cellular homeostasis. Macrophages are a major type of phagocytes that can produce a large amount of IL-10 in response to apoptotic cells (47). The clearance of ACs and the suppression of inflammation by IL-10 are required to prevent chronic inflammation and reduce atherosclerosis progression. So, next, we examined apoptotic cell-induced macrophage [M (AC)] activation in WT and SLC37A2-deficient macrophages. We first incubated Jurkat T cells with 1 μM staurosporine for 4 h to induce early apoptosis (Annexin V+, PI). Under this condition, 60% of Jurkat T cells underwent apoptosis (Supplementary Figures S7A,B). Compared to WT cells, SLC37A2-deficient macrophages showed a marked reduction in IL-10 expression at both transcriptional level (Figure 7A) and protein level (Figure 7B) in response to ACs. Engulfment of dead cells has been reported to elevate macrophage fatty acids and mitochondrial β-oxidation, which supports NAD+ homeostasis and IL-10 production (48). To explore the possible mechanisms of the attenuated M (AC) activation in SLC37A2-deficient macrophages, we first compared the efferocytosis index between genotypes. We found SLC37A2 deletion has no effect on phagocytosis of ACs over a 2-h period (Figure 7C). Blockade of phagocytosis by using cytochalasin D (Figure 7D) or blockade of fatty acid β-oxidation by etomoxir (Figure 7E) slightly reduced AC-induced IL-10 production in both genotypes but did not normalize the differential expression of IL-10 between genotypes. Interestingly, blockade of glycolysis using 2-DG led to a significant reduction of IL-10 in engulfed macrophages in both mouse genotypes (Figure 7F), suggesting that glycolysis plays an unappreciated role in AC-induced IL-10 production. More interestingly, the blockade of glycolysis normalized the differential IL-10 secretion between genotypes. Consistent with the profound anti-inflammatory effect of efferocytosis, AC-treated macrophages produced a very low level of TNF (100 pg/ml) (Supplementary Figures S7C–E), likely resulting from the low-grade (7.3%) cell death induced by staurosporine (Supplementary Figures S7A,B). Nevertheless, AC-induced TNF production was comparable between genotypes (Supplementary Figures S7C–E). Different from the drug effect on IL-10 production, cytochalasin D (Supplementary Figure S7C), etomoxir (Supplementary Figure S7D), or 2-DG (Supplementary Figure S7E) showed a more profound inhibitory effect on AC-induced TNF production in SLC37A2-deficient macrophages.

FIGURE 7
www.frontiersin.org

Figure 7. SLC37A2 deficiency impairs apoptotic cell-induced macrophage activation in vitro. (A) IL-10 transcript expression in WT and Slc37a2−/− BMDMs stimulated with apoptotic Jurkat T cells (ACs) (macrophages: ACs = 1:5) for 0-6 h. Jurkat T cells were incubated with 1 μM staurosporine for 4 h to induce apoptosis. (B) IL-10 protein secretion from WT and Slc37a2−/− BMDMs stimulated with ACs (macrophages: ACs = 1:5) for 4 h. (C) Efferocytosis index was measured by incubating WT and Slc37a2−/− BMDMs with cell tracker green CMFDA-labeled ACs (macrophages: ACs = 1:5) for 0-120 min. After the indicated time, macrophages were washed with cold PBS 3 times and cell dissociation buffer once before being analyzed by flow cytometry. Mean fluorescence intensity (MFI) of macrophages engulfing ACs was quantified. (D–F) IL-10 protein secretion from WT and Slc37a2−/− BMDMs pretreated with phagocytosis inhibitor cytochalasin D (Cyto D, 10 μM), fatty acid oxidation inhibitor etomoxir (100 μM), and hexokinase inhibitor 2-deoxy-D-glucose (2-DG; 10 mM) for 30 min, followed by co-culture with ACs (macrophages: ACs = 1:5) for 4 h. (G,H) Seahorse analysis of oxygen consumption rate (OCR) in WT and Slc37a2−/− BMDMs treated with or without ACs (macrophages: ACs = 1:5) for 3 h. (I,J) Seahorse analysis of extracellular acidification rates (ECAR) in WT and Slc37a2−/− BMDMs treated with or without ACs (macrophages: ACs = 1:5) for 3 h. Data are representative of two independent experiments with 3 samples per group (mean ± SEM). ***P < 0.001, ****P < 0.0001, unpaired, two-tailed Student's t-test (A–C). Bars with different letters denote significant among groups (p < 0.05); two-way ANOVA with post hoc Tukey's multiple comparisons test (D–J).

Next, we examined mitochondrial respiration and glycolysis by measuring OCR and ECAR, respectively. We found that ACs decreased mitochondrial OXPHOS when engulfed by macrophages regardless of genotypes, as shown by decreased maximal respiration without significant changes in basal respiration (Figures 7G,H). Furthermore, ACs promoted aerobic glycolysis in WT macrophages, and SLC37A2 deletion impaired AC-induced glycolysis (Figures 7I,J). No genotypic difference in glycolytic capacity was observed in AC-engulfed macrophages. Together, our results suggest that SLC37A2 positively regulates M (AC) activation through modulation of glycolysis and is likely independent of phagocytosis or fatty acid oxidation.

Discussion

As an ER-membrane anchored G6P transporter, SLC37A2 is a critical regulator of LPS-induced inflammation in macrophages by modulation of glycolysis (24). Herein, we made novel observations that SLC37A2 expression is necessary to maintain IL-4 and apoptotic cell-induced macrophage alternative activation in a glycolysis-independent and -dependently manner, respectively. Hematopoietic expression of SLC37A2 is atheroprotective in vivo under pro-atherogenic conditions. Disruption of SLC37A2 significantly impairs macrophage activation induced by IL-4 or apoptotic cells. Moreover, disruption of SLC37A2 in hematopoietic cells impairs anti-inflammatory responses and worsens atherogenesis in high-fat western diet-fed Ldlr−/− mice. Since LPS, oxLDL, and IL-4 induce macrophage SLC37A2 protein expression, we speculate that induction of macrophage SLC37A2 expression promotes inflammation resolution and slows atherosclerosis progression.

Cellular metabolism has emerged as an essential determinant of macrophage activation in response to microenvironmental cues. Macrophage pro-inflammatory activation was long thought to primarily rely on glucose metabolism, whereas M (IL-4) macrophages switch to fatty acid oxidation and mitochondrial biogenesis to support their anti-inflammatory functions (44). However, recent studies challenged this concept and suggested that fatty acid oxidation is dispensable for M (IL-4) macrophage polarization (49, 50). Whether glycolysis plays a role in M (IL-4) activation is also under debate and requires further investigation (45). Therefore, how macrophages reprogram cellular metabolism to favor M (IL-4) polarization remains poorly defined. In our study, SLC37A2 deficiency impairs M (IL-4) polarization independent of PPARs and PGC1. Given that SLC37A2 regulates glycolysis and mitochondrial OXPHOS in LPS-treated macrophages, we hypothesized that SLC37A2 might promote M (IL-4) activation by enhancing mitochondrial respiration. Our results showed that 24 h of IL-4 stimulation significantly increased glycolysis and mitochondrial respiration in macrophages regardless of SLC37A2 expression. Despite the impaired M (IL-4) activation, SLC37A2 deletion slightly increased mitochondrial respiration and had no effect on glycolysis in M (IL-4) macrophages. These results suggest that the impaired M (IL-4) activation in SLC37A2-deficient macrophages is likely regulated by unknown mechanisms rather than rewiring the glycolytic process or altering mitochondrial respiration. Additionally, mitochondrial β-oxidation of fatty acids derived from apoptotic cells has been shown to support efferocytosis-induced IL-10 production (48). Interestingly, despite a minimal effect on phagocytosis of apoptotic cells, SLC37A2 deletion significantly impairs apoptotic cell-induced IL-10, suggesting a critical role of SLC37A2 in M (AC) activation. Importantly, our study indicates that glycolysis plays a more significant role in AC-induced IL-10 production, as evidenced by the increased ECAR in AC-treated macrophages and a greater reduction of IL-10 in 2-DG-treated macrophages relative to etomoxir-treated cells. Our results agreed with Morioka's findings that efferocytosis promotes glucose uptake, glycolysis, and lactate production (51). Unlike LPS-treated macrophages in which SLC37A2 deletion promotes glycolysis, SLC37A2-deficient macrophages showed attenuated glycolysis in response to AC stimulation. Furthermore, blockade of glycolysis, but not phagocytosis or fatty acid oxidation, normalized the differential secretion of IL-10 between genotypes. Together, our results suggest that glucose metabolism plays a central role in SLC37A2-regulated M (AC) activation.

Our in vitro macrophage studies suggest that SLC37A2 deletion enhances pro-inflammatory activation in both LPS- and oxLDL-treated macrophages. However, hematopoietic SLC37A2 deletion does not cause elevated pro-inflammatory responses in WD-fed Ldlr−/− mice. Unexpectedly, plasma MCP-1 showed a 30% reduction in SLC37A2Δhema mice. MCP-1 is one of the critical chemokines that regulate the migration and infiltration of monocytes/macrophages. A higher circulating level of MCP-1 is associated with an increased long-term risk of stroke in the general population (52). Inhibition of MCP-1 (53) decreases plaque size and limits macrophage infiltration in experimental models of atherosclerosis. As discussed above, hematopoietic SLC37A2 deletion increases lipid deposition and necrotic core formation but does not enhance macrophage (CD68+ cells) infiltration in diet-fed Ldlr−/− mice. One possible explanation for the indistinguishable macrophage content between genotypes is the net effect of reducing anti-inflammatory IL-10 and pro-inflammatory MCP-1 in those knockout mice. Interestingly, IL-4 signaling induces MCP-1 expression in macrophages and other cells (5456). We observed a significant decrease in MCP-1 expression induced by IL-4 in SLC37A2-deficient macrophages. Whether the down-regulation of MCP-1 expression results from the impaired IL-4 response in WD-diet fed SLC37A2Δhema mice requires further investigation. On the other hand, macrophage heterogeneity is more complex as activation drives a spectrum of macrophages (12). The mixed pro-inflammatory and anti-inflammatory profile in diet-fed SLC37A2Δhema mice likely reflects the complex microenviroment (for instance, atherosclerotic plaque or liver tissue) that macrophages encounter in those mice.

Alternatively-activated macrophages promote tissue remodeling and repair through collagen formation and clearance of apoptotic cells (efferocytosis). Failure of efferocytosis leads to increased apoptosis and cell death. Alternatively-activated macrophages also secrete high levels of anti-inflammatory cytokines such as IL-10 (57). IL-10 is a crucial mediator of inflammation resolution and promotes efferocytosis by a positive feedback pathway (58). Blocking IL-10 accelerates atherosclerosis (59), whereas targeting the delivery of IL-10 via nanoparticles attenuates atherosclerosis (60). Consistent with the impaired anti-inflammatory activation of macrophages in vitro, our in vivo study showed that SLC37A2 deficiency in bone marrow lowers plasma IL-10 level and enhances atherosclerosis in WD-fed Ldlr−/− mice. Moreover, we observed that plasma IL-10, but not plasma cholesterol, displays an inverse correlation with aortic plaque size in diet-fed mice. Although no significant changes in apoptosis or efferocytosis in atherosclerotic plaques were observed between genotypes, loss of SLC37A2 in bone marrow did enlarge necrotic cores and decrease collagen deposition in the diet-fed mouse plaques. This could suggest secondary necrosis of apoptotic cells may have nonetheless occurred. Because SLC37A2 expression is necessary for anti-inflammatory macrophage activation in vitro and in vivo, we speculate that the impaired anti-inflammatory responses are a major driving force of enhanced atherosclerosis in the SLC37A2Δhema mice.

Alternative activation of hepatic macrophages promotes liver fatty acid oxidation and improves metabolic syndrome (36). One interesting observation in the current study is that the SLC37A2Δhema mice displayed elevated plasma and liver cholesterol concentrations, which likely increases the risk of atherosclerosis in those animals. Consistent with the increased hepatic lipid accumulation, SLC37A2Δhema mice showed lower expression of genes encoding fatty acid oxidation enzymes and less enrichment of anti-inflammatory macrophages in the liver after 16-wk WD feeding. Our data suggest that SLC37A2 expression is necessary for alternative activation of Kupffer cells under chronic metabolic stress conditions. Therefore, disruption of SLC37A2 impairs alternative activation of Kupffer cells, leading to decreased hepatic fatty acid oxidation and increased neutral lipid accumulation in the liver under atherogenic conditions. Additionally, bone marrow SLC37A2 deletion lowers the transcript expression of genes encoding cholesterol efflux and concomitantly upregulates the expression of genes responsible for oxLDL cholesterol uptake, suggesting that hematopoietic SLC37A2 deletion may partially promote hepatic neutral lipid accumulation by disrupting cholesterol efflux/uptake in the liver. Since Kupffer cell replacement in Slc37a2−/− BMT mice is incomplete (61), the modest elevation of plasma and liver lipids in the SLC37A2Δhema mice may underestimate the harmful effect of SLC37A2 deletion on liver lipid homeostasis in the context of atherosclerosis.

In summary, under in vivo pro-atherogenic conditions, hematopoietic SLC37A2 expression is necessary for maintaining alternative macrophage activation and IL-10 production. Loss of hematopoietic cell-specific SLC37A2 impairs anti-inflammatory activities at the cell (peritoneal macrophages), tissue (liver), and systemic (plasma) levels and accelerates atherosclerosis. Our study suggests that hematopoietic SLC37A2 expression protects against atherosclerosis in mice.

Limitations of the Study

One of the limitations of the BMT model is that BM contains multiple types of immune cells. Many of them, including T cells, B cells, neutrophils, and dendritic cells, are involved in atherogenesis. Because of this, we cannot distinguish the specific contribution of macrophage SLC37A2 from other immune cells to atherosclerosis. Additionally, we only examined atherosclerosis after 16-wks diet feeding, a more advanced stage of atherosclerosis. Lastly, we only used male Ldlr−/− mice as recipient mice to investigate the impact of hematopoietic SLC37A2 deficiency on the pathogenesis of atherogenesis and obesity and insulin resistance induced by high-fat diet feeding. Therefore, we do not know whether there is a sex-dependent effect of hematopoietic SLC37A2 expression on the pathogenesis of atherogenesis or not.

Data Availability Statement

The original contributions presented in the study are included in the article/Supplementary Materials, further inquiries can be directed to the corresponding author/s.

Ethics Statement

The animal study was reviewed and approved by Wake Forest University Animal Care and Use Committee.

Author Contributions

QZhao, ZW, AKM, MZ, and QZhang performed the experiments. EB helped with mouse necropsy. JM and MBF helped with multiplex assay and manuscript writing. F-CH helped with statistical analysis. CEM, CMF, and JSP helped with manuscript writing and data discussion. XZ conceived the study and wrote the manuscript. All authors contributed to the article and approved the submitted version.

Funding

This study was supported by NIEHS Z01 ES102005 (MBF), NIH R01 HL119962 (JSP), NIH R35 GM126922 (CEM), NIH R01 HL132035 (XZ), and NIH T32GM127261 and NIH T32AI007401 (AKM). The study was also supported by National Center for Advancing Translational Sciences of the National Institutes of Health under Award Number UL1TR001420 (Research Assistant fund to XZ).

Conflict of Interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher's Note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary Material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fcvm.2021.777098/full#supplementary-material

Abbreviations

AC, apoptotic cells; BMDM, bone marrow-derived macrophages; BMT, bone marrow transplantation; ECAR, extracellular acidification rate; NAD+, nicotinamide adenine dinucleotide; OCR, oxygen consumption rate; OXPHOS, oxidative phosphorylation; SLC37A2, solute carrier family 37 member 2; WD, western diet.

References

1. Amengual J, Barrett TJ. Monocytes and macrophages in atherogenesis. Curr Opin Lipidol. (2019) 30:401–8. doi: 10.1097/MOL.0000000000000634

PubMed Abstract | CrossRef Full Text | Google Scholar

2. Getz GS, Reardon CA. Atherosclerosis: cell biology and lipoproteins. Curr Opin Lipidol. (2020) 31:286–90. doi: 10.1097/MOL.0000000000000704

PubMed Abstract | CrossRef Full Text | Google Scholar

3. Bäck M, Yurdagul A Jr., Tabas I, Öörni K, Kovanen PT. Inflammation and its resolution in atherosclerosis: mediators and therapeutic opportunities. Nat Rev Cardiol. (2019) 16:389–406. doi: 10.1038/s41569-019-0169-2

PubMed Abstract | CrossRef Full Text | Google Scholar

4. Libby P, Bornfeldt KE. How far we have come, how far we have yet to go in atherosclerosis research. Circ Res. (2020) 126:1107–11. doi: 10.1161/CIRCRESAHA.120.316994

PubMed Abstract | CrossRef Full Text | Google Scholar

5. Flynn MC, Pernes G, Lee MKS, Nagareddy PR, Murphy AJ. Monocytes, macrophages, and metabolic disease in atherosclerosis. Front Pharmacol. (2019) 10:666. doi: 10.3389/fphar.2019.00666

PubMed Abstract | CrossRef Full Text | Google Scholar

6. Remmerie A, Scott CL. Macrophages and lipid metabolism. Cell Immunol. (2018) 330:27–42. doi: 10.1016/j.cellimm.2018.01.020

PubMed Abstract | CrossRef Full Text | Google Scholar

7. Rader DJ, Puré E. Lipoproteins, macrophage function, and atherosclerosis: beyond the foam cell? Cell Metab. (2005) 1:223–30. doi: 10.1016/j.cmet.2005.03.005

PubMed Abstract | CrossRef Full Text | Google Scholar

8. Hansson GK, Libby P, Tabas I. Inflammation and plaque vulnerability. J Intern Med. (2015) 278:483–93. doi: 10.1111/joim.12406

PubMed Abstract | CrossRef Full Text | Google Scholar

9. Yvan-Charvet L, Ivanov S. Metabolic reprogramming of macrophages in atherosclerosis: is it all about cholesterol? J Lipid Atheroscl. (2020) 9:231–42. doi: 10.12997/jla.2020.9.2.231

PubMed Abstract | CrossRef Full Text | Google Scholar

10. Koelwyn GJ, Corr EM, Erbay E, Moore KJ. Regulation of macrophage immunometabolism in atherosclerosis. Nat Immunol. (2018) 19:526–37. doi: 10.1038/s41590-018-0113-3

PubMed Abstract | CrossRef Full Text | Google Scholar

11. Wang Y, Zhao M, Liu S, Guo J, Lu Y, Cheng J, et al. Macrophage-derived extracellular vesicles: diverse mediators of pathology and therapeutics in multiple diseases. Cell Death Dis. (2020) 11:924. doi: 10.1038/s41419-020-03127-z

PubMed Abstract | CrossRef Full Text | Google Scholar

12. Xue J, Schmidt SV, Sander J, Draffehn A, Krebs W, Quester I, et al. Transcriptome-based network analysis reveals a spectrum model of human macrophage activation. Immunity. (2014) 40:274–88. doi: 10.1016/j.immuni.2014.01.006

PubMed Abstract | CrossRef Full Text | Google Scholar

13. Moore KJ, Sheedy FJ, Fisher EA. Macrophages in atherosclerosis: a dynamic balance. Nat Rev Immunol. (2013) 13:709–21. doi: 10.1038/nri3520

PubMed Abstract | CrossRef Full Text | Google Scholar

14. Stremmel C, Stark K, Schulz C. Heterogeneity of macrophages in atherosclerosis. Thromb Haemost. (2019) 119:1237–46. doi: 10.1055/s-0039-1692665

PubMed Abstract | CrossRef Full Text | Google Scholar

15. O'Neill LA, Kishton RJ, Rathmell J. A guide to immunometabolism for immunologists. Nat Rev Immunol. (2016) 16:553–65. doi: 10.1038/nri.2016.70

PubMed Abstract | CrossRef Full Text | Google Scholar

16. O'Neill LA, Pearce EJ. Immunometabolism governs dendritic cell and macrophage function. J Exp Med. (2016) 213:15–23. doi: 10.1084/jem.20151570

PubMed Abstract | CrossRef Full Text | Google Scholar

17. Pearce EL, Pearce EJ. Metabolic pathways in immune cell activation and quiescence. Immunity. (2013) 38:633–43. doi: 10.1016/j.immuni.2013.04.005

PubMed Abstract | CrossRef Full Text | Google Scholar

18. Rudd JH, Warburton EA, Fryer TD, Jones HA, Clark JC, Antoun N, et al. Imaging atherosclerotic plaque inflammation with [18F]-fluorodeoxyglucose positron emission tomography. Circulation. (2002) 105:2708–11. doi: 10.1161/01.CIR.0000020548.60110.76

PubMed Abstract | CrossRef Full Text | Google Scholar

19. Freemerman AJ, Zhao L, Pingili AK, Teng B, Cozzo AJ, Fuller AM, et al. Myeloid Slc2a1-deficient murine model revealed macrophage activation and metabolic phenotype are fueled by GLUT1. J Immunol. (2019) 202:1265–86. doi: 10.4049/jimmunol.1800002

PubMed Abstract | CrossRef Full Text | Google Scholar

20. Nishizawa T, Kanter JE, Kramer F, Barnhart S, Shen X, Vivekanandan-Giri A, et al. Testing the role of myeloid cell glucose flux in inflammation and atherosclerosis. Cell Rep. (2014) 7:356–65. doi: 10.1016/j.celrep.2014.03.028

PubMed Abstract | CrossRef Full Text | Google Scholar

21. Chou JY, Sik Jun H, Mansfield BC. The SLC37 family of phosphate-linked sugar phosphate antiporters. Mol Aspects Med. (2013) 34:601–11. doi: 10.1016/j.mam.2012.05.010

PubMed Abstract | CrossRef Full Text | Google Scholar

22. Kim JY, Tillison K, Zhou S, Wu Y, Smas CM. The major facilitator superfamily member Slc37a2 is a novel macrophage- specific gene selectively expressed in obese white adipose tissue. Am J Physiol Endocrinol Metab. (2007) 293:E110–20. doi: 10.1152/ajpendo.00404.2006

PubMed Abstract | CrossRef Full Text | Google Scholar

23. Pan CJ, Chen SY, Jun HS, Lin SR, Mansfield BC, Chou JY. SLC37A1 and SLC37A2 are phosphate-linked, glucose-6-phosphate antiporters. PLoS ONE. (2011) 6:e23157. doi: 10.1371/journal.pone.0023157

PubMed Abstract | CrossRef Full Text | Google Scholar

24. Wang Z, Zhao Q, Nie Y, Yu Y, Misra BB, Zabalawi M, et al. Solute carrier family 37 member 2 (SLC37A2) negatively regulates murine macrophage inflammation by controlling glycolysis. iScience. (2020) 23:101125. doi: 10.1016/j.isci.2020.101125

PubMed Abstract | CrossRef Full Text | Google Scholar

25. Wang Z, Sequeira RC, Zabalawi M, Madenspacher J, Boudyguina E, Ou T, et al. Myeloid atg5 deletion impairs n-3 PUFA-mediated atheroprotection. Atherosclerosis. (2020) 295:8-17. doi: 10.1016/j.atherosclerosis.2020.01.004

PubMed Abstract | CrossRef Full Text | Google Scholar

26. Liao X, Sluimer JC, Wang Y, Subramanian M, Brown K, Pattison JS, et al. Macrophage autophagy plays a protective role in advanced atherosclerosis. Cell Metab. (2012) 15:545–53. doi: 10.1016/j.cmet.2012.01.022

PubMed Abstract | CrossRef Full Text | Google Scholar

27. Li S, Sun Y, Liang CP, Thorp EB, Han S, Jehle AW, et al. Defective phagocytosis of apoptotic cells by macrophages in atherosclerotic lesions of ob/ob mice and reversal by a fish oil diet. Circ Res. (2009) 105:1072–82. doi: 10.1161/CIRCRESAHA.109.199570

PubMed Abstract | CrossRef Full Text | Google Scholar

28. Thorp E, Cui D, Schrijvers DM, Kuriakose G, Tabas I. Mertk receptor mutation reduces efferocytosis efficiency and promotes apoptotic cell accumulation and plaque necrosis in atherosclerotic lesions of apoe-/- mice. Arterioscl Thromb Vasc Biol. (2008) 28:1421–8. doi: 10.1161/ATVBAHA.108.167197

PubMed Abstract | CrossRef Full Text | Google Scholar

29. Schrijvers DM, De Meyer GR, Kockx MM, Herman AG, Martinet W. Phagocytosis of apoptotic cells by macrophages is impaired in atherosclerosis. Arterioscl Thromb Vasc Biol. (2005) 25:1256–61. doi: 10.1161/01.ATV.0000166517.18801.a7

PubMed Abstract | CrossRef Full Text | Google Scholar

30. Shen L, Yang Y, Ou T, Key CC, Tong SH, Sequeira RC, et al. Dietary PUFAs attenuate NLRP3 inflammasome activation via enhancing macrophage autophagy. J Lipid Res. (2017) 58:1808–21. doi: 10.1194/jlr.M075879

PubMed Abstract | CrossRef Full Text | Google Scholar

31. Zhu X, Chung S, Bi X, Chuang CC, Brown AL, Liu M, et al. Myeloid cell-specific ABCA1 deletion does not worsen insulin resistance in HF diet-induced or genetically obese mouse models. J Lipid Res. (2013) 54:2708–17. doi: 10.1194/jlr.M038943

PubMed Abstract | CrossRef Full Text | Google Scholar

32. Bi X, Zhu X, Gao C, Shewale S, Cao Q, Liu M, et al. Myeloid cell-specific ATP-binding cassette transporter A1 deletion has minimal impact on atherogenesis in atherogenic diet-fed low-density lipoprotein receptor knockout mice. Arterioscl Thromb Vasc Biol. (2014) 34:1888–99. doi: 10.1161/ATVBAHA.114.303791

PubMed Abstract | CrossRef Full Text | Google Scholar

33. Carr TP, Andresen CJ, Rudel LL. Enzymatic determination of triglyceride, free cholesterol, and total cholesterol in tissue lipid extracts. Clin Biochem. (1993) 26:39–42. doi: 10.1016/0009-9120(93)90015-X

PubMed Abstract | CrossRef Full Text | Google Scholar

34. Zhu X, Lee JY, Timmins JM, Brown JM, Boudyguina E, Mulya A, et al. Increased cellular free cholesterol in macrophage-specific Abca1 knock-out mice enhances pro-inflammatory response of macrophages. J Biol Chem. (2008) 283:22930–41. doi: 10.1074/jbc.M801408200

PubMed Abstract | CrossRef Full Text | Google Scholar

35. McGillicuddy FC, M., de la Llera Moya, Hinkle CC, Joshi MR, Chiquoine EH, Billheimer JT, et al. Inflammation impairs reverse cholesterol transport in vivo. Circulation. (2009) 119:1135–45. doi: 10.1161/CIRCULATIONAHA.108.810721

PubMed Abstract | CrossRef Full Text | Google Scholar

36. Odegaard JI, Ricardo-Gonzalez RR, Red Eagle A, Vats D, Morel CR, Goforth MH, et al. Alternative M2 activation of Kupffer cells by PPARdelta ameliorates obesity-induced insulin resistance. Cell Metab. (2008) 7:496–507. doi: 10.1016/j.cmet.2008.04.003

PubMed Abstract | CrossRef Full Text | Google Scholar

37. Xu W, Roos A, Schlagwein N, Woltman AM, Daha MR, van Kooten C. IL-10-producing macrophages preferentially clear early apoptotic cells. Blood. (2006) 107:4930-7. doi: 10.1182/blood-2005-10-4144

PubMed Abstract | CrossRef Full Text | Google Scholar

38. Tabas I. Macrophage death and defective inflammation resolution in atherosclerosis. Nat Rev Immunol. (2010) 10:36–46. doi: 10.1038/nri2675

PubMed Abstract | CrossRef Full Text | Google Scholar

39. Poon IK, Lucas CD, Rossi AG, Ravichandran KS. Apoptotic cell clearance: basic biology and therapeutic potential. Nature Rev Immunol. (2014) 14:166–80. doi: 10.1038/nri3607

PubMed Abstract | CrossRef Full Text | Google Scholar

40. Deguchi JO, Aikawa E, Libby P, Vachon JR, Inada M, Krane SM, et al. Matrix metalloproteinase-13/collagenase-3 deletion promotes collagen accumulation and organization in mouse atherosclerotic plaques. Circulation. (2005) 112:2708–15. doi: 10.1161/CIRCULATIONAHA.105.562041

PubMed Abstract | CrossRef Full Text | Google Scholar

41. Rekhter MD. Collagen synthesis in atherosclerosis: too much and not enough. Cardiovasc Res. (1999) 41:376–84. doi: 10.1016/S0008-6363(98)00321-6

PubMed Abstract | CrossRef Full Text | Google Scholar

42. Libby P, Ridker PM, Hansson GK. Progress and challenges in translating the biology of atherosclerosis. Nature. (2011) 473:317–25. doi: 10.1038/nature10146

PubMed Abstract | CrossRef Full Text | Google Scholar

43. Maiolino G, Rossitto G, Caielli P, Bisogni V, Rossi GP, Calò LA. The role of oxidized low-density lipoproteins in atherosclerosis: the myths and the facts. Mediators Inflamm. (2013) 2013:714653. doi: 10.1155/2013/714653

PubMed Abstract | CrossRef Full Text | Google Scholar

44. Vats D, Mukundan L, Odegaard JI, Zhang L, Smith KL, Morel CR, et al. Oxidative metabolism and PGC-1beta attenuate macrophage-mediated inflammation. Cell Metab. (2006) 4:13–24. doi: 10.1016/j.cmet.2006.08.006

PubMed Abstract | CrossRef Full Text | Google Scholar

45. Huang SC, Smith AM, Everts B, Colonna M, Pearce EL, Schilling JD, et al. Metabolic reprogramming mediated by the mTORC2-IRF4 signaling axis is essential for macrophage alternative activation. Immunity. (2016) 45:817–30. doi: 10.1016/j.immuni.2016.09.016

PubMed Abstract | CrossRef Full Text | Google Scholar

46. Wang F, Zhang S, Vuckovic I, Jeon R, Lerman A, Folmes CD, et al. Glycolytic stimulation is not a requirement for M2 macrophage differentiation. Cell Metab. (2018) 28:463–75.e464. doi: 10.1016/j.cmet.2018.08.012

PubMed Abstract | CrossRef Full Text | Google Scholar

47. Chung EY, Liu J, Homma Y, Zhang Y, Brendolan A, Saggese M, et al. Interleukin-10 expression in macrophages during phagocytosis of apoptotic cells is mediated by homeodomain proteins Pbx1 and Prep-1. Immunity. (2007) 27:952–64. doi: 10.1016/j.immuni.2007.11.014

PubMed Abstract | CrossRef Full Text | Google Scholar

48. Zhang S, Weinberg S, DeBerge M, Gainullina A, Schipma M, Kinchen JM, et al. Efferocytosis fuels requirements of fatty acid oxidation and the electron transport chain to polarize macrophages for tissue repair. Cell Metab. (2019) 29:443–56.e445. doi: 10.1016/j.cmet.2018.12.004

PubMed Abstract | CrossRef Full Text | Google Scholar

49. Divakaruni AS, Hsieh WY, Minarrieta L, Duong TN, Kim KKO, Desousa BR, et al. Etomoxir inhibits macrophage polarization by disrupting CoA homeostasis. Cell Metab. (2018) 28:490–503.e497. doi: 10.1016/j.cmet.2018.06.001

PubMed Abstract | CrossRef Full Text | Google Scholar

50. Van den Bossche J, van der Windt GJW. Fatty acid oxidation in macrophages and T cells: time for reassessment? Cell Metab. (2018) 28:538-40. doi: 10.1016/j.cmet.2018.09.018

PubMed Abstract | CrossRef Full Text | Google Scholar

51. Morioka S, Perry JSA, Raymond MH, Medina CB, Zhu Y, Zhao L, et al. Efferocytosis induces a novel SLC program to promote glucose uptake and lactate release. Nature. (2018) 563:714–8. doi: 10.1038/s41586-018-0735-5

PubMed Abstract | CrossRef Full Text | Google Scholar

52. Georgakis MK, Malik R, Björkbacka H, Pana TA, Demissie S, Ayers C, et al. Circulating monocyte chemoattractant protein-1 and risk of stroke: meta-analysis of population-based studies involving 17 180 individuals. Circ Res. (2019) 125:773–82. doi: 10.1161/CIRCRESAHA.119.315380

PubMed Abstract | CrossRef Full Text | Google Scholar

53. Gu L, Okada Y, Clinton SK, Gerard C, Sukhova GK, Libby P, et al. Absence of monocyte chemoattractant protein-1 reduces atherosclerosis in low density lipoprotein receptor-deficient mice. Mol Cell. (1998) 2:275–81. doi: 10.1016/S1097-2765(00)80139-2

PubMed Abstract | CrossRef Full Text | Google Scholar

54. Rollins BJ, Pober JS. Interleukin-4 induces the synthesis and secretion of MCP-1/JE by human endothelial cells. Am J Pathol. (1991) 138:1315–9.

PubMed Abstract | Google Scholar

55. Kikuchi H, Hanazawa S, Takeshita A, Nakada Y, Yamashita Y, Kitano S. Interleukin-4 acts as a potent stimulator for expression of monocyte chemoattractant JE/MCP-1 in mouse peritoneal macrophages. Biochem Biophys Res Commun. (1994) 203:562–9. doi: 10.1006/bbrc.1994.2219

PubMed Abstract | CrossRef Full Text | Google Scholar

56. Ovsiy I, Riabov V, Manousaridis I, Michel J, Moganti K, Yin S, et al. IL-4 driven transcription factor FoxQ1 is expressed by monocytes in atopic dermatitis and stimulates monocyte migration. Sci Rep. (2017) 7:16847. doi: 10.1038/s41598-017-17307-z

PubMed Abstract | CrossRef Full Text | Google Scholar

57. Saraiva M, Vieira P, O'Garra A. Biology and therapeutic potential of interleukin-10. J Exp Med. (2020) 217:jem.20190418. doi: 10.1084/jem.20190418

PubMed Abstract | CrossRef Full Text | Google Scholar

58. Ogden CA, Pound JD, Batth BK, Owens S, Johannessen I, Wood K, et al. Enhanced apoptotic cell clearance capacity and B cell survival factor production by IL-10-activated macrophages: implications for Burkitt's lymphoma. J Immunol. (2005) 174:3015–23. doi: 10.4049/jimmunol.174.5.3015

PubMed Abstract | CrossRef Full Text | Google Scholar

59. Caligiuri G, Rudling M, Ollivier V, Jacob MP, Michel JB, Hansson GK, et al. Interleukin-10 deficiency increases atherosclerosis, thrombosis, and low-density lipoproteins in apolipoprotein E knockout mice. Mol Med. (2003) 9:10–7. doi: 10.1007/BF03402102

PubMed Abstract | CrossRef Full Text | Google Scholar

60. Kamaly N, Fredman G, Fojas JJ, Subramanian M, Choi WI, Zepeda K, et al. Targeted interleukin-10 nanotherapeutics developed with a microfluidic chip enhance resolution of inflammation in advanced atherosclerosis. ACS Nano. (2016) 10:5280–92. doi: 10.1021/acsnano.6b01114

PubMed Abstract | CrossRef Full Text | Google Scholar

61. Kennedy DW, Abkowitz JL. Kinetics of central nervous system microglial and macrophage engraftment: analysis using a transgenic bone marrow transplantation model. Blood. (1997) 90:986–93. doi: 10.1182/blood.V90.3.986

PubMed Abstract | CrossRef Full Text | Google Scholar

Keywords: glucose 6-phosphate transporter, macrophage inflammation, IL-10, efferocytosis, atherosclerosis

Citation: Zhao Q, Wang Z, Meyers AK, Madenspacher J, Zabalawi M, Zhang Q, Boudyguina E, Hsu F-C, McCall CE, Furdui CM, Parks JS, Fessler MB and Zhu X (2021) Hematopoietic Cell-Specific SLC37A2 Deficiency Accelerates Atherosclerosis in LDL Receptor-Deficient Mice. Front. Cardiovasc. Med. 8:777098. doi: 10.3389/fcvm.2021.777098

Received: 14 September 2021; Accepted: 16 November 2021;
Published: 10 December 2021.

Edited by:

Yiliang Chen, Medical College of Wisconsin, United States

Reviewed by:

Fang Li, Columbia University Irving Medical Center, United States
Darcy Knaack, Medical College of Wisconsin, United States

Copyright © 2021 Zhao, Wang, Meyers, Madenspacher, Zabalawi, Zhang, Boudyguina, Hsu, McCall, Furdui, Parks, Fessler and Zhu. This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.

*Correspondence: Xuewei Zhu, eHd6aHUmI3gwMDA0MDt3YWtlaGVhbHRoLmVkdQ==

These authors have contributed equally to this work

Disclaimer: All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.