Abstract
Multiple studies have demonstrated that acute ethanol consumption alters brain function and cognition. Nevertheless, the mechanisms underlying this phenomenon remain poorly understood. Astrocyte-mediated gliotransmission is crucial for hippocampal plasticity, and recently, the opening of hemichannels has been found to play a relevant role in this process. Hemichannels are plasma membrane channels composed of six connexins or seven pannexins, respectively, that oligomerize around a central pore. They serve as ionic and molecular exchange conduits between the cytoplasm and extracellular milieu, allowing the release of various paracrine substances, such as ATP, D-serine, and glutamate, and the entry of ions and other substances, such as Ca2+ and glucose. The persistent and exacerbated opening of hemichannels has been associated with the pathogenesis and progression of several brain diseases for at least three mechanisms. The uncontrolled activity of these channels could favor the collapse of ionic gradients and osmotic balance, the release of toxic levels of ATP or glutamate, cell swelling and plasma membrane breakdown and intracellular Ca2+ overload. Here, we evaluated whether acute ethanol exposure affects the activity of astrocyte hemichannels and the possible repercussions of this phenomenon on cytoplasmatic Ca2+ signaling and gliotransmitter release. Acute ethanol exposure triggered the rapid activation of connexin43 and pannexin1 hemichannels in astrocytes, as measured by time-lapse recordings of ethidium uptake. This heightened activity derived from a rapid rise in [Ca2+]i linked to extracellular Ca2+ influx and IP3-evoked Ca2+ release from intracellular Ca2+ stores. Relevantly, the acute ethanol-induced activation of hemichannels contributed to a persistent secondary increase in [Ca2+]i. The [Ca2+]i-dependent activation of hemichannels elicited by ethanol caused the increased release of ATP and glutamate in astroglial cultures and brain slices. Our findings offer fresh perspectives on the potential mechanisms behind acute alcohol-induced brain abnormalities and propose targeting connexin43 and pannexin1 hemichannels in astrocytes as a promising avenue to prevent deleterious consequences of alcohol consumption.
1 Introduction
Acute alcohol intoxication has far-reaching effects on the central nervous system (CNS), leading to compromised decision-making (George et al., 2005), heightened aggression (Massa et al., 2019), reduced ability to intervene in bystander situations (Leone and Parrott, 2019), and a higher propensity for intoxicated driving despite the risks (Motschman et al., 2020). The effects of acute alcohol intoxication begin with mild impairments in tasks requiring skills, along with dysmetria, slower reaction times, increased talkativeness, and relaxation at blood alcohol levels (BAL) of 5–20 mM (Jung and Namkoong, 2014). At higher BAL (20–40 mM), individuals experience slowed thinking and altered cognitive processing. When the BAL reaches 40 mM and above, some may even encounter memory “blackouts,” where they engage in complex behaviors but have no memory of them afterward (White, 2003). These blackouts indicate a temporary inability to form new memories and can lead to severe outcomes. When BAL exceeds 86.8 mM, severe consequences like respiratory depression, coma, and potentially death can occur (Vonghia et al., 2008).
Early onset of alcohol intoxication is a significant risk factor for later alcohol bingeing and the development of alcohol addiction (DeWit et al., 2000; Morean et al., 2014; Whelan et al., 2014), a chronically relapsing condition characterized by compulsive alcohol-seeking and consumption (Carvalho et al., 2019). While many studies have focused on the effects of chronic alcohol exposure on the brain, our understanding of the neural adaptations triggered by acute alcohol intake remains incomplete. It is crucial to understand how ethanol directly affects brain networks to pinpoint new therapeutic targets for reducing excessive drinking and mitigating the public health consequences of acute alcohol intoxication. In recent years, an emerging idea suggests that ethanol-induced brain changes may partly be influenced by its direct effects on non-neuronal cells, particularly astrocytes (Hong et al., 2021; Kim et al., 2022; Coulter et al., 2023). Among other key functions, such as energy supplier or extracellular K+ buffering, astrocytes play a crucial role in the “tripartite synapse,” which is central to chemical synaptic transmission (Allen and Eroglu, 2017). They sense neural activity and respond by releasing bioactive molecules called “gliotransmitters,” a process tightly dependent on intracellular free Ca2+ concentration ([Ca2+]i) (Araque et al., 2014). These gliotransmitters regulate cerebral blood flow, facilitate energy-rich metabolite exchange, and contribute to immune response and brain interstitial fluid homeostasis (Weber and Barros, 2015; Verkhratsky and Nedergaard, 2018). Ethanol, the main component of alcoholic beverages, triggers acute effects on astrocytes, including increased expression of NF-κB, iNOS and COX-2 (Blanco et al., 2004; Blanco et al., 2005). Furthermore, ethanol causes a rapid increase in [Ca2+]i and disrupts the communication between astrocytes, as well as the release of gliotransmitters (Kimelberg et al., 1993; Allansson et al., 2001; Adermark et al., 2004; Kim et al., 2022). However, the mechanisms behind these alterations and the profound impact of astroglial dysfunction on ethanol-induced brain abnormalities are still unclear.
Recently, our group conducted a couple of studies that have highlighted the activation of hemichannels as a novel mechanism through which long-lasting exposure to ethanol disrupts astrocyte state (Gómez et al., 2018; Gómez et al., 2024). This involves a cascade of inflammatory pathways being sequentially stimulated, ultimately resulting in astrocyte damage. Unlike most plasma membrane channels, which selectively allow ions such as K+, Na+, and Cl− to pass through, hemichannels serve as conduits for both ions and small molecules due to their larger pore diameters (Montero and Orellana, 2015). Hemichannels are made up of six connexin or seven pannexin monomers surrounding a central pore, facilitating the passage of substances between the cytosol and the extracellular space (Giaume et al., 2013). While connexin and pannexin hemichannels both fall within the category of large-pore channels (Syrjanen et al., 2021), they differ significantly in terms of amino acid sequence, permeability, conductance, as well as gating and posttranslational mechanisms that regulate them (D'Hondt et al., 2013; Patel et al., 2014; Esseltine and Laird, 2016). In the CNS, astrocytes express functional hemichannels composed mainly by connexin 43 (C× 43) and pannexin-1 (Panx1), facilitating the release of gliotransmitters essential for synaptic transmission, plasticity, behavior, and memory (Chever et al., 2014; Meunier et al., 2017; Cheung et al., 2022; Linsambarth et al., 2022; Vasile et al., 2022). However, during pathological conditions, the heightened activity of these channels in astrocytes contributes to homeostatic disturbances associated with the pathogenesis and progression of various brain diseases (Garré et al., 2016; Chávez et al., 2019; Gajardo-Gómez et al., 2020; Almad et al., 2022; Guo et al., 2022). Research suggests that uncontrolled influx of Na+ and Cl− through hemichannels can lead to osmotic and ionic imbalances, resulting in aquaporin-mediated cell swelling and plasma membrane breakdown (Paul et al., 1991; Diaz et al., 2019). Moreover, the persistent and dysregulated opening of hemichannels, which are permeable to Ca2+ and/or indirectly increase [Ca2+]i, may lead to [Ca2+]i overload, triggering the production of free radicals, lipid peroxidation, and plasma membrane damage (Giaume et al., 2021). Alternatively, exacerbated activity of these channels could also induce the release of potentially harmful molecules such as glutamate, ATP, and D-serine to neighboring cells (Orellana et al., 2016).
In this study, we demonstrate that acute ethanol exposure rapidly increases the activity of hemichannels in cortical astrocytes and in HeLa cells expressing either Cx43 or Panx1. The latter response depended on a rise in [Ca2+]i driven by extracellular Ca2+ influx and IP3-induced Ca2+ release from intracellular stores. Importantly, the acute ethanol-induced activity of astroglial hemichannels resulted in increased release of ATP and glutamate, as observed in culture and brain slice preparations.
2 Material and methods
2.1 Reagents and antibodies
HEPES, water (W3500), ethanol, DNAse I, poly-L-lysine, ATP, glutamate determination kit and probenecid (Prob) were purchased from Sigma-Aldrich (St. Louis, MO, United States). Fetal bovine serum (FBS) was obtained from Hyclone (Logan, UT, United States). Penicillin, streptomycin, Trypsin 10×, Hank’s solution, ATP determination kit, Dulbecco’s Modified Eagle Medium (DMEM), Phosphate-Buffered Saline (PBS) and ethidium (Etd) bromide (10 mg/mL) were purchased from Thermo Fisher Scientific (Waltham, MA, United States). Gap19 (KQIEIKKFK, intracellular loop domain of Cx43), gap19I130A (KQAEIKKFK, negative control), TaT-L2 (YGRKKRRQRRRDGANVDMHLKQIEIKKFKYGIEEHGK, second intracellular loop domain of Cx43), TaT-L2H126K/I130N (YGRKKRRQRRR-DGANVDMKLKQNEIKKFKYGIEEHGK, negative control), 10panx1 (WRQAAFVDSY, first extracellular loop domain of Panx1) and 10panx1 scramble (10panx1scrb, FSVYWAQADR) peptides were obtained from Genscript (New Jersey, United States).
2.2 Animals
Animal experimentation was conducted in accordance with the guidelines for the care and use of experimental animals of the US National Institutes of Health (NIH), the ad hoc committee of the Agencia Nacional de Investigación y Desarrollo (ANID), the Bioethics Committee of the Pontificia Universidad Católica de Chile (PUC) (n°: 200605010) and the guidelines of European Community Council Directives of 01/01/2013 (2010/63/EU) and the animal care committee of the Center for Interdisciplinary Research in Biology in College de France. C57BL/6 (PUC) mice of 8–9 weeks of age were housed in cages in a temperature-controlled (24°C) and humidity-controlled vivarium under a 12 h light/dark cycle (lights on 8:00 a.m.), with ad libitum access to food and water. Some experiments were carried out using mice of wild-type C57BL/6j background, mice expressing enhanced green fluorescent protein under the astrocytic promoter glial fibrillary acidic protein (GFAP-eGFP) provided by F. Kirchhoff (University of Saarland, Germany).
2.3 Cell cultures
Astroglial cell primary cultures were prepared from the cortex of postnatal day 2 (P2) mice as previously described (Avendano et al., 2015). Briefly, brains were removed, and cortices were dissected. Meninges were carefully peeled off and tissue was mechanically dissociated in Ca2+ and Mg2+ free Hank’s balanced salt solution with 0.25% trypsin and 1% DNAse. Cells were seeded onto 35-mm plastic dishes (Corning, NY, United States) or onto glass coverslips (Fisher Scientific, Waltham, MA, United States) placed inside 24-well plastic plates (Corning, NY, United States) at the density of 3 × 105 cells/dish or 1x105 cells/well, respectively, in DMEM, supplemented with penicillin (5 U/mL), streptomycin (5 μg/mL), and 10% FBS. Cells were grown at 37°C in a 5% CO2/95% air atmosphere at nearly 100% relative humidity. Following 8–10 days in vitro (DIV), 1 µM AraC was added for 3 days to suppress the proliferation of microglia. Medium was changed twice a week and cultures were used after 3 weeks. Parental HeLa cells knock-out for Cx45 (HeLa-KO45) were used to ensure no endogenous expression of this connexin. HeLa cells were stably transfected with mouse Cx43EGFP or Panx1EGFP, with EGFP fused to the C-terminus of these proteins, as previously described (Salas et al., 2015; Harcha et al., 2019). Cells were cultured in low glucose DMEM media supplemented with 10% FBS as well as 50 U/mL penicillin and streptomycin at 37°C in a 5% CO2/95% air atmosphere. Cells were selected by their resistance to the antibiotic geneticin (G418, maintained with 1 mg/mL in the medium). The culture medium was replaced every other day.
2.4 Acute brain slices
Mice were anesthetized under isoflurane, decapitated and brains were extracted and cut into coronal slices (300 µm) using a vibratome (Leica, VT1000GS; Leica, Wetzlar, Germany) filled with ice-cold slicing solution containing (in mM): sucrose (222); KCl (2.6); NaHCO3 (27); NaHPO4 (1.5); glucose (10); MgSO4 (7); CaCl2 (0.5) and ascorbate (0.1), bubbled with 95% O2/5% CO2, pH 7.4. The substitution of NaCl by sucrose reduces the Na+ driving force, minimizing Na+ entry into cells and thereby reducing excitotoxicity (Aghajanian and Rasmussen, 1989). Additionally, this slicing solution has a low Ca2+/high Mg2+ ratio, which ensures very low neural excitability. Then, the slices were transferred at room temperature (20°C–22°C) to a holding chamber in ice-cold artificial cerebral spinal fluid (aCSF) containing (in mM): NaCl (125), KCl (2.5), glucose (25), NaHCO3 (25), NaH2PO4 (1.25), CaCl2 (2), and MgCl2 (1), bubbled with 95% O2/5% CO2, pH 7.4, for a stabilization period of 60 min before dye uptake experiments (see below).
2.5 Treatments
Astrocytes or HeLa-cells were acutely treated with 0, 1, 10, 25, 50, or 100 mM of EtOH. The following pharmacological agents or conditions were used 30 min prior and during acute stimulation with ethanol during experiments: Ca2+-free solution, mimetic peptides against Cx43 (gap19: 50 μM; TaT-L2: 50 µM) and Panx1 (10panx1, 50 µM) hemichannels, mutated peptides against Cx43 hemichannels (gap 1919I130A: 50 μM; TaT-L2H126K/I130N: 50 µM), scramble peptide against Panx1 hemichannels (10panx1scrb, 50 µM), Probenecid (Prob, Panx1 hemichannel blocker, 200 µM), BAPTA-AM (intracellular Ca2+ chelator, 10 μM), thapsigargin (TG, compound that depletes the intracellular Ca2+ stores, 2 µM), xestospongin C (Xest-C, IP3 receptor blocker, 5 µM), xestospongin B (Xest-B, IP3 receptor blocker, 5 µM), ryanodine (general RyR receptor blocker, 100 μM) or dantrolene (RyR1 receptor blocker, 50 µM). Acute brain slices were acutely treated with 25 mM EtOH. Some acute brain slices were pre-incubated for 30 min before and during acute EtOH experiments with the following agents: gap19 (50 µM), 10panx1 (50 µM), BAPTA-AM (10 μM) or Xest-C (5 µM). In some experiments, hemichannel blockers were also used acutely to inhibit Etd uptake. Conditioned media (CM) from astrocytes or brain slices were obtained from supernatants collected after 10 min of acute ethanol exposure, filtered (0.22 µm), and stored at −80°C.
2.6 Dye uptake in cultured cells
For dye uptake experiments in astrocytes, they were plated on 12 mm glass coverslips and, after 2 weeks of culture, were washed twice in Hank´s balanced salt solution. Then, astrocytes were incubated at room temperature with recording solution (in mM): 148 NaCl, 5 KCl, 1.8 CaCl2, 1 MgCl2, 5 glucose, and 5 HEPES, pH 7.4, containing 5 μM Etd and mounted on the stage of an Olympus BX 51W1I upright microscope with a ×40 water immersion objective for time-lapse imaging. Images were captured by a Retiga 1300I fast-cooled monochromatic digital camera (12-bit) (Qimaging, Burnaby, BC, Canada) controlled by imaging software Metafluor software (Universal Imaging, Downingtown, PA) every 30 s (exposure time = 0.5 s; excitation and emission wavelengths were 528 nm 598 nm, respectively). For dye uptake experiments in HeLa cells, they were first seeded on 25 mm glass coverslips and used when they reached 70%–80% confluency. Then, they were bathed with recording Krebs solution (in mM): 118 NaCl, 4.7 KCl, 3 CaCl2, 1.2 MgCl2, 10 glucose, 20 HEPES, 9.9 Tris; pH 7.4; containing 5 µM DAPI. Fluorescence intensity images were recorded in cells that were selected for having a fluorescent label, indicating that they express Cx43EGFP or Panx1EGFP. The images were taken with a NIKON Eclipse Ti inverted microscope (Japan) every 15 s for 5 min per condition. Nikon software (NIS Elements Advanced Research) was used for off-line image analysis. For astrocytes and HeLa cells, the fluorescence intensity recorded from at least 20 regions of interest (representing 20 cells per cultured coverslip) was calculated with the following formula: Corrected total cell fluorescence = Integrated Density—([Area of selected cell] x [Mean fluorescence of background readings]). The mean slope of the relationship over a given time interval (ΔF/ΔT) represents the dye uptake rate and was calculated with regression lines that were fitted to points before and after the various experimental conditions using Microsoft Excel (Seattle, WA, United States). The mean values of slopes were plotted using GraphPad Prism 7 software (La Jolla, California, United States) and expressed as AU/min. At least three replicates (four sister cultured coverslips) were measured in each independent experiment. In some experiments, cultured astrocytes or HeLa cells were pre-incubated with Cx43 and/or Panx1 channel blockers for 15 min before and during the time-lapse experiments of dye uptake: gap19 (50 µM), TaT-L2 (50 µM), 10panx1 (50 µM), gap19I130A (50 µM), TaT-L2H126K/I130N (50 µM), 10panx1scrb (50 µM) or Prob (200 µM).
2.7 Intracellular Ca2+ imaging
Astrocytes plated on glass coverslips were loaded with 5 µM Fura-2-AM in DMEM without serum at 37°C for 45 min and then washed three times in Locke’s solution (154 mM NaCl, 5.4 mM KCl, 2.3 mM CaCl2, 5 mM HEPES, pH 7.4) followed by de-esterification at 37°C for 15 min. The experimental protocol for Ca2+ signal imaging involved data acquisition every 5 s (emission at 510 nm) at 340/380-nm excitation wavelengths, respectively, using an Olympus BX 51W1I upright microscope with a ×40 water immersion objective. Changes were monitored using an imaging system equipped with a Retga 1300I fast-cooled monochromatic digital camera (12-bit) (Qimaging, Burnaby, BC, Canada), monochromator for fluorophore excitation, and METAFLUOR software (Universal Imaging, Downingtown, PA) for image acquisition and analysis. Analysis involved determination of pixels assigned to each cell. The average pixel value allocated to each cell was obtained with excitation at each wavelength and corrected for background. Due to the low excitation intensity, no bleaching was observed even when cells were illuminated for a few minutes. The FURA-2 ratio was obtained after dividing the 340-nm by the 380-nm fluorescence image on a pixel-by-pixel base (R = F340 nm/F380 nm).
2.8 Dye uptake in acute brain slices
Time-lapse recordings of Etd uptake in brain slices were done in a submerged recording chamber perfused with oxygenated aCSF containing 20 μM Etd at a flow rate of 4–5 mL/min at room temperature (22°C). To stabilize the tissue and prevent it from moving within the fluid stream, we utilized a slice-anchor or “harp” constructed from nylon or gold threads stretched and secured across a U-shaped piece of gold or platinum wire. Image time series were acquired with a TCS SP5 upright two-photon microscope (Leica) with aHCX IRAPO, L 25x, NA = 0.95, water immersion objective (Leica). Fluorophores were excited at 800 nm using a Ti:Sapphire laser (MaiTai, −0.1 MW, Spectra-Physics, Santa Clara, CA, US). Laser power below the objective was kept between 20 and 40 mW to minimize laser-induced artefacts and phototoxicity. Fluorescence light was collected in the epifluorescence configuration. The Etd fluorescence was separated from the GFP fluorescence using a dichroic mirror (562 nm, Semrock, US). Fluorescence emissions were detected simultaneously by two non-descanned photomultiplier tubes with a 542/50 nm filter for “green” fluorescence emission and a 617/73 nm filter for “red” fluorescence emission. XY time-lapse series of basal and EtOH-induced Etd uptake were subsequently recorded for 30 min at 0.03 Hz, at a depth of 100–150 μm beneath the surface. Leica Application Suite Advanced Fluorescence (LASAF) and ImageJ/FIJI software were used for off-line image analysis. Etd fluorescence intensity was calculated with the following formula: Corrected total cell fluorescence = Integrated Density–([Area of selected cell] x [Mean fluorescence of background readings]). The mean slope of the relationship over a given time interval (ΔF/ΔT) represents the dye uptake rate and was calculated with regression lines that were fitted to points before and after the various experimental conditions using Microsoft Excel (Seattle, WA, United States). The mean values of slopes were plotted using GraphPad Prism 7 software (La Jolla, California, United States) and expressed as arbitrary units (AU)/min. In some time-lapse recordings, brain slices were acutely treated with the following inhibitors after acute treatment with EtOH: gap19 (50 µM) or 10panx1 (50 µM).
2.9 Measurement of extracellular ATP and glutamate concentration
Extracellular ATP in CM was measured using a luciferin/luciferase bioluminescence assay kit (Sigma-Aldrich), while extracellular levels of glutamate were determined using an enzyme-linked fluorometric assay (Sigma-Aldrich). Cells were lysed with a Tris-buffered solution containing 1% TritonX-100 and supernatants of whole-cell lysates were used for measurements of protein levels. The amounts of ATP and glutamate in the samples were calculated from standard curves and normalized for the protein concentration using the Bio-Rad protein assay.
2.10 Astrocyte morphology
Astrocytes plated on glass coverslips were incubated in Locke’s solution and then imaged using a Nikon Eclipse Ti2-E inverted microscope with a 60x, NA = 1.49, APO TIRF DIC oil immersion objective (Tokyo, Japan). Changes in differential interference contrast microscopy were monitored using an imaging system equipped with a Nikon DS-Fi2 Camera (Tokyo, Japan). XY time-lapse series of basal and acute EtOH exposure were subsequently recorded every 3 s for 5 min. ImageJ/FIJI software were used for off-line image analysis. Then, images were converted into binary (black-and-white) images through the default thresholding method (IsoData algorithm of ImageJ). The following parameters related to astroglial morphology were measured: “Area,” “Perimeter” and “Aspect ratio”. The mean values were plotted using GraphPad Prism 7 software (La Jolla, California, United States).
2.11 Data analysis and statistics
Detailed statistical results were included in the figure legends. Statistical analyses were performed using GraphPad Prism (version 7, GraphPad Software, La Jolla, CA). Normality and equal variances were assessed using the Shapiro-Wilk normality test and Brown-Forsythe test, respectively. Unless otherwise stated, data that passed these tests were analyzed by unpaired t-test in case of comparing two groups, whereas in case of multiple comparisons, data were analyzed by one or two-way analysis of variance (ANOVA) followed, in case of significance, by a Tukey’s post hoc test. A probability of p < 0.05 was considered statistically significant.
3 Results
3.1 Acute ethanol exposure increases the activity of Cx43 and Panx1 hemichannels in cultured astrocytes
Acute stimulation with ethanol causes a rapid augment in the expression of NF-κB, iNOS and COX-2 (Blanco et al., 2004; Blanco et al., 2005) along with a rise in [Ca2+]i and release of taurine and aspartate in astrocytes (Kimelberg et al., 1993; Allansson et al., 2001; Adermark et al., 2004; Kim et al., 2022). However, the molecular mechanisms underlying these alterations remain still unclear. We recently showed that long-lasting stimulation (hours to days) elevates the activity of Cx43 and Panx1 hemichannels in astrocytes (Gómez et al., 2024). Yet, it is unclear whether acute ethanol exposure (seconds to minutes) could affect the activity of these channels in primary cortical astrocytes. To evaluate the functional status of hemichannels in astrocytes, we measured the uptake rate of ethidium (Etd), a dye that enters the cytoplasm of healthy cells through plasma membrane channels with large pores (Johnson et al., 2016). Upon intercalating with base pairs of DNA and RNA, Etd becomes fluorescent, indicating channel activity. Time-lapse recordings showed that acute ethanol stimulation instantly doubled the Etd uptake rate in cultured astrocytes (Figures 1A–F). We observed similar responses when astrocytes were incubated with ethanol for 1 min and then placed on the microscope stage to record the Etd uptake rate over time (Figure 1G). The increase in Etd uptake induced by acute ethanol was concentration-dependent, peaking at 25 mM and gradually declining with higher concentrations (Figure 1H). Therefore, we decided to use 25 mM ethanol for our subsequent experiments.
FIGURE 1
Since both Cx43 and Panx1 hemichannels play a significant role in dye influx in astrocytes (Iglesias et al., 2009; Sáez et al., 2020), we investigated their potential involvement in the acute ethanol-induced Etd uptake. The contribution of Cx43 hemichannels to acute ethanol-mediated Etd uptake was explored using gap19 and TaT-L2, two mimetic peptides that inhibit Cx43 hemichannels by interacting with the intracellular L2 loop of Cx43 (Iyyathurai et al., 2013). Both gap19 (50 µM) or TaT-L2 (50 µM) effectively reduced the acute ethanol-induced Etd uptake in astrocytes, although not completely (Figures 1I,J). Furthermore, an inactive form of gap19, containing the I130A modification (gap19I130A), was ineffective in reducing the acute ethanol-induced Etd uptake in astrocytes (Figure 1J). Similarly, we observed that a modified TaT-L2 (TaT-L2H126K/I130N), in which two amino acids crucial for binding L2 to the CT tail of Cx43 are mutated, did not elicit a similar inhibitory response (Figure 1J). To examine the role of Panx1 hemichannels, we pharmacologically inhibited them with the mimetic peptide 10panx1 (50 µM) or probenecid (500 µM) (Pelegrin and Surprenant, 2006; Silverman et al., 2008). Both 10panx1 or probenecid partially attenuated the acute ethanol-induced Etd uptake in astrocytes (Figure 1J). Similar inhibitory responses were observed by employing the scrambled version of 10panx1 (10panx1scrb, 50 µM) (Figure 1J). Significantly, the simultaneous administration of gap19 and 10panx1 completely blocked acute ethanol-induced Etd uptake (Figure 1J), suggesting that acute ethanol exposure rapidly augments the activity of both Cx43 and Panx1 hemichannels in astrocytes. The acute ethanol-induced activation of hemichannels was not associated with changes in the area, perimeter, or aspect ratio of astrocytes (Supplementary Figure S1A). This indicates that astroglial morphology remained unchanged in our system.
We previously showed that treatment for 24 h with ethanol increases the activity of Cx43 and Panx1 hemichannels expressed in HeLa cells (Gómez et al., 2024). To explore whether acute ethanol-induced hemichannel activity observed in astrocytes can be reproduced in an exogenous expression system, we transfected HeLa cells with Cx43 or Panx1 tagged with EGFP. These transfected cells express hemichannels on their cell surface, enabling them to uptake and release small molecules, including dyes commonly used to assess hemichannel activity, such as DAPI (Salas et al., 2015; Harcha et al., 2019). Acute ethanol treatment rapidly led to a six-fold increase in DAPI uptake in HeLa-Cx43EGFP cells (Figures 2A,B). All ethanol concentrations tested (1–100 mM) significantly increased DAPI uptake, showing a bell-shaped pattern with 25 mM producing the maximum effect (Figure 2B). Similarly, HeLa-Panx1EGFP cells exposed to acute ethanol displayed a similar bell-shaped increase in DAPI uptake, peaking at 25 mM, but significant effects were observed at concentrations equal to or greater than 10 mM (Figures 2C,D). Importantly, following stimulation with various ethanol concentrations, HeLa-parental cells (non-transfected) showed no alterations in DAPI uptake, indicating that acute ethanol specifically enhances the activity of Cx43 and Panx1 hemichannels in HeLa cells (Figure 2E). In line with these findings, 50 µM gap19 or 50 µM 10panx1 effectively blocked the acute ethanol-induced increase in DAPI uptake in HeLa-Cx43EGFP and HeLa-Panx1EGFP cells, respectively (Figure 2F).
FIGURE 2
3.2 Extracellular Ca2+ influx and Ca2+ release from intracellular stores contribute to the acute ethanol-induced activation of Cx43 and Panx1 hemichannels in cultured astrocytes
Moderate increases (>500 nM) in [Ca2+]i trigger the opening of Cx43 hemichannels (De Bock et al., 2012), a response similarly observed with Panx1 hemichannels (Locovei et al., 2006; López et al., 2021). Furthermore, [Ca2+]i dynamics regulate astroglial activation, function, and the release of gliotransmitters through various pathways (Volterra et al., 2014), including those associated with the opening of Cx43 hemichannels (Meunier et al., 2017). Given that acute ethanol exposure is known to rapidly elevate [Ca2+]i in astrocytes (Allansson et al., 2001; Kim et al., 2022), we aim to investigate the molecular mechanisms underlying this phenomenon and whether hemichannels play a role in it. As depicted by time-lapse measurements of Fura-2 ratio (340/380), acute treatment with 25 mM ethanol elicited a rapid, intense, and transient increase in the Ca2+ signal, peaking at approximately 680% compared to basal levels (Figures 3A–C). This initial response was succeeded by a secondary or “post-peak” prolonged increase that gradually reached a plateau over the recording time (Figure 3C). To delve deeper into this response, we depleted the bath solution of Ca2+ or inhibited IP3-evoked Ca2+ release from intracellular Ca2+ stores using xestospongin C (Xest-C). Both the absence of extracellular Ca2+ or Xest-C (5 µM) attenuated the acute ethanol-induced increase in the amplitude and area under the curve of the [Ca2+]i peak (Figures 3C–F). Notably, the secondary and persistent Ca2+ response triggered by acute ethanol was nearly completely blocked in the absence of extracellular Ca2+, while Xest-C only caused a slight reduction (Figures 3C,D,F). Remarkably, the combined depletion of extracellular Ca2+ and treatment with Xest-C completely abolished both the acute ethanol-induced [Ca2+]i peak and the subsequent secondary [Ca2+]i response (Figures 3E,F). Similar inhibitory effects were observed with BAPTA-AM (10 µM), an [Ca2+]i chelator (Figures 3C, E, F). Together, these findings suggest that the rapid [Ca2+]i peak triggered by ethanol in astrocytes relies on both extracellular Ca2+ influx and IP3-evoked Ca2+ release from intracellular Ca2+ stores. In contrast, the sustained secondary [Ca2+]i response primarily depends on extracellular Ca2+ rather than Ca2+ released from intracellular stores.
FIGURE 3
We investigated the potential involvement of Cx43 and Panx1 hemichannels in the acute ethanol-induced rise in [Ca2+]i signal using gap19 or 10panx1, respectively. Interestingly, neither gap19 (50 µM) nor 10panx1 (50 µM) affected the acute [Ca2+]i peak elicited by ethanol (Figures 3D–F). However, the combined action of both inhibitors completely abolished the sustained secondary [Ca2+]i response triggered by acute ethanol (Figures 3D–F). These findings, along with the inhibitory effect of the extracellular Ca2+-free solution, suggest that Cx43 and Panx1 hemichannels contribute to the persistent secondary extracellular Ca2+ influx triggered by acute ethanol. With this in mind, we then scrutinized whether the acute rise in [Ca2+]i evoked by ethanol might be driving the heightened hemichannel activity caused by this substance. Both BAPTA-AM (10 µM) or the combined depletion of extracellular Ca2+ and treatment with Xest-C (5 µM) totally suppressed the acute ethanol-induced Etd uptake in astrocytes (Figures 4A–D). Partial inhibitory effects were observed upon depleting intracellular Ca2+ stores with thapsigargin (2 µM) or blocking IP3-evoked Ca2+ release from intracellular Ca2+ stores with Xest-C (5 µM) or xestospongin-B (5 μM, another IP3 receptor inhibitor) (Figure 4D). More pronounced blocking effects were observed upon depleting extracellular Ca2+ from the bath solution (Figure 4D). Interestingly, inhibiting ryanodine receptors (RyRs) with 100 µM ryanodine (a general RyR blocker) or 50 µM dantrolene (a specific RyR type-1 inhibitor) did not diminish the acute ethanol-mediated increase in Etd uptake by astrocytes (Figure 4D). Similarly, the presence of high extracellular K+ (50 mM) failed in modulate the acute ethanol-mediated increase in Etd uptake by astrocytes (Supplementary Figure S1E). Collectively, these findings emphasize that both extracellular Ca2+ influx and IP3-evoked Ca2+ release from intracellular Ca2+ stores cause the activation of hemichannels upon acute ethanol stimulation.
FIGURE 4
3.3 Acute ethanol-induced activation of Cx43 and Panx1 hemichannels leads to [Ca2+]i-dependent gliotransmitter release by astrocytes
There is mounting evidence suggesting a rapid surge in extracellular ATP and glutamate levels during adverse brain conditions such as trauma (Globus et al., 1995; Davalos et al., 2005), hypoxia/ischemia (Nishizawa, 2001; Melani et al., 2005), or epilepsy-related seizures (Wieraszko and Seyfried, 1989; Albrecht and Zielinska, 2017). The prolonged elevation of ATP in brain dysfunction suggests controlled mechanisms of ATP release linked to the activation of danger signaling rather than mere leakage. Likewise, the excitotoxic release of glutamate is a characteristic hallmark implicated in mediating neuronal death due to exacerbated activation of excitatory amino acid receptors. Building upon prior research indicating that acute ethanol exposure boosts the release of ATP and glutamate by astrocytes (Salazar et al., 2008; Kim et al., 2021), we investigated this phenomenon within our system and explored the potential involvement of hemichannels. Examination of conditioned media (CM) obtained from astrocytes exposed to ethanol for 10 min showed elevated extracellular concentrations of ATP and glutamate compared to control conditions (Figures 5A,B). Significantly, 10panx1 or probenecid notably suppressed the acute ethanol-induced release of ATP (Figure 5A). Conversely, inhibition of Cx43 hemichannels (using gap19 or TaT-L2) elicited only a minor counteractive effect (Figure 5A). Interestingly, a different impact of hemichannels was noted in the release of glutamate compared to ATP levels when analyzing the CM. Certainly, we found that gap19 or TaT-L2 significantly dampened the acute ethanol-induced release of glutamate (Figure 5B). Additionally, inhibiting Panx1 hemichannels was effective, though to a lesser degree compared to blocking Cx43 hemichannels (Figure 5B). The next step was to figure out whether the acute ethanol-induced release of ATP and glutamate by astrocytes depended on [Ca2+]i. As occurred with the hemichannel activation elicited by acute ethanol exposure, both BAPTA-AM or the combined depletion of extracellular Ca2+ and treatment with Xest-C (5 µM) totally suppressed the acute ethanol-induced release of ATP and glutamate by astrocytes (Figures 5A,B). The [Ca2+]i dependency response mentioned above was associated with extracellular Ca2+ influx rather than Ca2+ release from intracellular stores. This was evidenced by the fact that the inhibitory effect of Xest-C on gliotransmitter release was weaker compared to the depletion of extracellular Ca2+ (Figures 5A,B). Altogether, these findings suggest that acute ethanol exposure causes the release of gliotransmitters by astrocytes by a mechanism that involves the [Ca2+]i-dependent activation of Cx43 and Panx1 hemichannels.
FIGURE 5
To investigate the effects of acute ethanol on astrocytes within a more integrative setting, we investigated whether this substance could change hemichannel function in hippocampal astrocytes from the stratum radiatum in acute brain slices. Accordingly, we conducted time-lapse recordings of Etd uptake in eGFP-GFAP-positive astrocytes upon acute exposure to 25 mM ethanol. Hippocampal astrocytes exhibited a 2.3-fold rise in Etd uptake following acute ethanol treatment (Figures 6A–F). This increase was accompanied by elevated release of ATP and glutamate, as determined by luciferin/luciferase and colorimetric analysis, respectively, of CM from brain slices stimulated with 25 mM ethanol (Figures 6F,G). Both Etd uptake and transmitter release induced by acute ethanol were significantly reduced by gap19 (50 µM) or 10panx1 (50 µM) (Figures 6F,G). In line with findings from cultures, inhibiting Cx43 hemichannels proved more effective than blocking Panx1 hemichannels in reducing the release of glutamate induced by acute ethanol, whereas the opposite trend was observed for ATP release (Figure 6G). Likewise, both BAPTA-AM and the combined depletion of extracellular Ca2+ with Xest-C (5 µM) completely suppressed the acute ethanol-induced rise in Etd uptake and release of ATP and glutamate in brain slices (Figures 6F,G). In summary, these observations suggest that acute ethanol exposure induces the rapid activation of Cx43 and Panx1 hemichannels by hippocampal astrocytes in brain slices, resulting in the further release of ATP and glutamate in a [Ca2+]i-dependent manner.
FIGURE 6
4 Discussion
Here, we provide the first evidence that acute ethanol exposure triggers the rapid activation of Cx43 and Panx1 hemichannels in astrocytes. This heightened activity stems from a rapid rise in [Ca2+]i linked to extracellular Ca2+ influx and IP3-evoked Ca2+ release from intracellular Ca2+ stores. Relevantly, the acute ethanol-induced activation of hemichannels contributes to a persistent secondary increase in [Ca2+]i. Furthermore, the [Ca2+]i-dependent activation of astroglial hemichannels elicited by ethanol leads to the notable release of ATP and glutamate in cultures and brain slices. Indeed, through the assessment of Etd uptake, we demonstrated that acute ethanol rapidly increases the activity of Cx43 and Panx1 hemichannels in a bell-shaped concentration-dependent manner. Treatment with gap19 and TaT-L2, broadly established mimetic peptides known to antagonize Cx43 hemichannel opening (Iyyathurai et al., 2013), significantly counteracted the acute ethanol-induced Etd uptake. Similar inhibitory effects were observed with the blockade of Panx1 hemichannels using 10panx1 or probenecid (Pelegrin and Surprenant, 2006; Silverman et al., 2008), highlighting the substantial contributions of both Cx43 and Panx1 hemichannels to rapid ethanol-induced Etd uptake. These observations were further confirmed using inactive and/or scramble forms of these peptides. Consistent with this, acute ethanol-induced activation of hemichannels was also observed in HeLa cells expressing exogenous Cx43EGFP or Panx1EGFP, but not in parental HeLa cells devoid of both hemichannels. This indicates that the rapid activation of hemichannels evoked by ethanol depends entirely on the specific expression of Cx43 or Panx1 in an additive manner.
Previously, we reported that cultured astrocytes stimulated with ethanol for hours to days exhibit an enhanced activation of Cx43 and Panx1 hemichannels (Gómez et al., 2024). However, the temporal range employed in that study did not permit us to establish whether ethanol acutely modulates the function of astroglial hemichannels. Our current data are consistent with the notion that ethanol acutely boosts the activity of hemichannels with significant repercussions for [Ca2+]i signaling and the release of relevant paracrine molecules by astrocytes. The concentration of ethanol (25 mM) that elicited the highest activation of astrocytic hemichannels in both cell cultures and brain slice preparations corresponds with clinically relevant blood alcohol levels (BALs) associated with binge drinking (White, 2003). The expression of both Cx26 and Cx30 has been reported in astrocytes (Nagy et al., 2003). While Cx30 can form hemichannels (Nielsen et al., 2017; Xu and Nicholson, 2023), functional Cx30 hemichannels in astrocytes have only been described in one report (Ghezali et al., 2020). Similarly, Cx26 forms functional hemichannels (Ripps et al., 2004; González et al., 2006), but to our knowledge, evidence demonstrating the Cx26 hemichannel activity in astrocytes is lacking. Further studies are needed to determine if the acute stimulatory effects of ethanol also occur in other hemichannel-forming proteins, such as Cx26 and Cx30.
How does acute ethanol stimulation cause the activation of Cx43 and Panx1 hemichannels in astrocytes? Early hypotheses suggested that ethanol’s lipid solubility primarily affects cell membranes, with secondary effects on cellular proteins (Samson and Harris, 1992). However, contemporary understanding reveals that ethanol interacts with ethanol-sensitive membrane proteins by binding to hydrophobic pockets, leading to conformational shifts or alterations in kinetics that affect protein function (Diamond and Gordon, 1997; Fadda and Rossetti, 1998). Changes in [Ca2+]i homeostasis induced by ethanol have been identified as significant contributors to its effects on synaptic function and plasticity (Catlin et al., 1999; Walter and Messing, 1999). Here, we observed that acute ethanol-induced activation of hemichannels relies on both extracellular Ca2+ influx and IP3-evoked Ca2+ release from intracellular Ca2+ stores. These findings are coherent with previous studies showing that a moderate rise in [Ca2+]i induces the activation of Cx43 and Panx1 hemichannels (Locovei et al., 2006; De Bock et al., 2012; López et al., 2021). Crucially, the phosphorylation of Panx1 amino acid residue S394 by Ca2+/calmodulin-dependent protein kinase II (CaMKII) is essential for the [Ca2+]i-dependent activation of Panx1 hemichannels (López et al., 2021). A similar mechanism has been proposed to occur during the [Ca2+]i-mediated activation of connexin hemichannels (Hu et al., 2020). The latter is relevant because CaMKII activation in response to ethanol occurs rapidly (<60 s) and robustly following the rapid increase of [Ca2+]i (Garic et al., 2011). Future studies are needed to elucidate whether the acute ethanol-induced activation of Cx43 and Panx1 hemichannels occurs via the stimulation of CaMKII in astrocytes.
At this moment, the mechanisms underlying the acute ethanol-induced rise in [Ca2+]i remain unclear. However, since only the combined depletion of extracellular Ca2+ and treatment with Xest-C completely blocked the acute ethanol-induced [Ca2+]i peak, this phenomenon likely relies on extracellular Ca2+ influx and IP3-evoked Ca2+ release from intracellular Ca2+ stores. More importantly, our data suggest that the rapid [Ca2+]i peak is followed by a persistent secondary influx of extracellular Ca2+ through Cx43 and Panx1 hemichannels. This aligns with prior studies indicating that hemichannels are permeable to Ca2+ and/or their activation leads to the indirect increase of [Ca2+]i via activation of plasma membrane receptors and/or receptor-gated Ca2+ store (Schalper et al., 2010; Fiori et al., 2012; Lee et al., 2020; Yang et al., 2020). The rise in [Ca2+]i regulate the function astrocytes (Volterra et al., 2014), including the release of gliotransmitters through several pathways (Goenaga et al., 2023). In this study, we showed that acute ethanol stimulation triggers the rapid release of ATP and glutamate through the activation of Cx43 and Panx1 hemichannels in a [Ca2+]i-dependent manner. Interestingly, we noted that acute ethanol induces a differential release of ATP or glutamate depending on the hemichannel-forming protein (Cx43 or Panx1) in both culture and brain slice preparations. Specifically, inhibiting Panx1 hemichannels was more effective in reducing ATP release, whereas the opposite trend was observed for glutamate release when compared to inhibiting Cx43 hemichannels. We reported a similar gliotransmitter release behavior in cultured astrocytes treated for hours to days with ethanol (Gómez et al., 2024). The latter could be explained by the fact that, although both channels allow Etd passage, they may play different roles in releasing ATP and glutamate in our setting. While this might seem puzzling, recent studies suggest that hemichannels are not indiscriminate non-selective pores; rather, they selectively permeate certain molecules in an isoform-specific manner (Hansen et al., 2014a; Hansen et al., 2014b; Nielsen et al., 2017). Therefore, the uptake of fluorescent dyes may not precisely correlate with permeation to ions or small biologically relevant molecules, a characteristic that could even vary under pathological conditions (Gaete and Contreras, 2020; Sáez et al., 2020).
Acute ethanol intoxication poses a persistent hazard to society, leading to traffic accidents, injuries, and violence. It is widely documented that acute ethanol exposure has varied effects on neuronal activity across different brain regions, including the striatum, hippocampus, cerebellum, amygdala, substantia nigra, and ventral tegmental area (Abrahao et al., 2017). This impairs decision-making, judgement, and cognitive control, and can cause amnestic episodes, commonly referred to as memory “blackouts,” associated with binge drinking (White, 2003; George et al., 2005). Memory blackouts can have profound personal and societal consequences, particularly among adolescents and young adults, and may predict further cognitive difficulties with persistent alcohol use (White, 2003; Parada et al., 2011). This and other adverse brain effects can persist in the alcohol hangover period when BAL levels have dropped to zero (Silvestre de Ferron et al., 2015; Gunn et al., 2018; Contreras et al., 2019). The natural release of gliotransmitters from astroglial hemichannels regulates fundamental aspects of synaptic transmission, plasticity, memory, learning, and behavior (Chever et al., 2014; Meunier et al., 2017; Cheung et al., 2022; Linsambarth et al., 2022; Vasile et al., 2022). Therefore, it is plausible to hypothesize that the rapid release of gliotransmitters induced by ethanol through these channels could reconfigure synaptic networks and circuits, leading to unexpected effects on memory and behavior. Our findings offer fresh perspectives on the potential mechanisms behind acute alcohol-induced brain abnormalities and propose targeting Cx43 and Panx1 hemichannels in astrocytes as a promising avenue for treating such conditions.
Statements
Data availability statement
The original contributions presented in the study are included in the article/Supplementary Material, further inquiries can be directed to the corresponding authors.
Ethics statement
The animal study was approved by the Bioethics Committee of the Pontificia Universidad Católica de Chile (PUC) (n°: 200605010). The study was conducted in accordance with the local legislation and institutional requirements.
Author contributions
GG: Conceptualization, Data curation, Formal Analysis, Investigation, Methodology, Writing–original draft, Writing–review and editing. CG-R: Data curation, Formal Analysis, Methodology, Writing–original draft, Writing–review and editing, Investigation. JEM: Formal Analysis, Investigation, Methodology, Writing–original draft, Writing–review and editing. SAV: Data curation, Formal Analysis, Methodology, Writing–original draft, Writing–review and editing, Investigation. TFA: Formal Analysis, Investigation, Writing–original draft, Writing–review and editing. AF-P: Formal Analysis, Investigation, Writing–original draft, Writing–review and editing. JCS: Resources, Supervision, Validation, Writing–original draft, Writing–review and editing. MAR: Data curation, Formal Analysis, Investigation, Resources, Supervision, Validation, Writing–original draft, Writing–review and editing. MR: Conceptualization, Resources, Writing–original draft, Writing–review and editing, Investigation, Supervision. FOC: Conceptualization, Resources, Validation, Writing–original draft, Writing–review and editing, Investigation. JAO: Conceptualization, Data curation, Formal Analysis, Funding acquisition, Methodology, Project administration, Resources, Validation, Writing–original draft, Writing–review and editing.
Funding
The author(s) declare that financial support was received for the research, authorship, and/or publication of this article. This work was supported by the Agencia Nacional de Investigación y Desarrollo (ANID) and Fondo Nacional de Desarrollo Científico y Tecnológico (FONDECYT) Grants 1210375 (to JAO), 11171155 (to MR), 1231523 (to JCS) and 1210940 (to FCO).
Acknowledgments
We would like to offer special thanks to Dr. Christian Giaume, who, although no longer with us, continues to inspire by his example and dedication to the students he served over the course of his career. He contributed resources and supervised the two-photon microscopy experiments.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
The author(s) declared that they were an editorial board member of Frontiers, at the time of submission. This had no impact on the peer review process and the final decision
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fcell.2024.1422978/full#supplementary-material
References
1
AbrahaoK. P.SalinasA. G.LovingerD. M. (2017). Alcohol and the brain: neuronal molecular targets, synapses, and circuits. Neuron96, 1223–1238. 10.1016/j.neuron.2017.10.032
2
AdermarkL.OlssonT.HanssonE. (2004). Ethanol acutely decreases astroglial gap junction permeability in primary cultures from defined brain regions. Neurochem. Int.45, 971–978. 10.1016/j.neuint.2004.06.007
3
AghajanianG. K.RasmussenK. (1989). Intracellular studies in the facial nucleus illustrating a simple new method for obtaining viable motoneurons in adult rat brain slices. Synapse3, 331–338. 10.1002/syn.890030406
4
AlbrechtJ.ZielinskaM. (2017). Mechanisms of excessive extracellular glutamate accumulation in temporal lobe epilepsy. Neurochem. Res.42, 1724–1734. 10.1007/s11064-016-2105-8
5
AllanssonL.KhatibiS.OlssonT.HanssonE. (2001). Acute ethanol exposure induces [Ca2+]i transients, cell swelling and transformation of actin cytoskeleton in astroglial primary cultures. J. Neurochem.76, 472–479. 10.1046/j.1471-4159.2001.00097.x
6
AllenN. J.ErogluC. (2017). Cell Biology of astrocyte-synapse interactions. Neuron96, 697–708. 10.1016/j.neuron.2017.09.056
7
AlmadA. A.TagaA.JosephJ.GrossS. K.WelshC.PatankarA.et al (2022). Cx43 hemichannels contribute to astrocyte-mediated toxicity in sporadic and familial ALS. Proc. Natl. Acad. Sci. U. S. A.119, e2107391119. 10.1073/pnas.2107391119
8
AraqueA.CarmignotoG.HaydonP. G.OlietS. H.RobitailleR.VolterraA. (2014). Gliotransmitters travel in time and space. Neuron81, 728–739. 10.1016/j.neuron.2014.02.007
9
AvendanoB. C.MonteroT. D.ChávezC. E.Von BernhardiR.OrellanaJ. A. (2015). Prenatal exposure to inflammatory conditions increases Cx43 and Panx1 unopposed channel opening and activation of astrocytes in the offspring effect on neuronal survival. Glia63, 2058–2072. 10.1002/glia.22877
10
BlancoA. M.PascualM.VallesS. L.GuerriC. (2004). Ethanol-induced iNOS and COX-2 expression in cultured astrocytes via NF-kappa B. Neuroreport15, 681–685. 10.1097/00001756-200403220-00021
11
BlancoA. M.VallesS. L.PascualM.GuerriC. (2005). Involvement of TLR4/type I IL-1 receptor signaling in the induction of inflammatory mediators and cell death induced by ethanol in cultured astrocytes. J. Immunol.175, 6893–6899. 10.4049/jimmunol.175.10.6893
12
CarvalhoA. F.HeiligM.PerezA.ProbstC.RehmJ. (2019). Alcohol use disorders. Lancet394, 781–792. 10.1016/S0140-6736(19)31775-1
13
CatlinM. C.GuizzettiM.CostaL. G. (1999). Effects of ethanol on calcium homeostasis in the nervous system: implications for astrocytes. Mol. Neurobiol.19, 1–24. 10.1007/BF02741375
14
ChávezC. E.OyarzunJ. E.AvendanoB. C.MelladoL. A.InostrozaC. A.AlvearT. F.et al (2019). The opening of connexin 43 hemichannels alters hippocampal astrocyte function and neuronal survival in prenatally LPS-exposed adult offspring. Front. Cell Neurosci.13, 460. 10.3389/fncel.2019.00460
15
CheungG.BataveljicD.VisserJ.KumarN.MoulardJ.DalleracG.et al (2022). Physiological synaptic activity and recognition memory require astroglial glutamine. Nat. Commun.13, 753. 10.1038/s41467-022-28331-7
16
CheverO.LeeC. Y.RouachN. (2014). Astroglial connexin43 hemichannels tune basal excitatory synaptic transmission. J. Neurosci.34, 11228–11232. 10.1523/JNEUROSCI.0015-14.2014
17
ContrerasA.MoralesL.Del OlmoN. (2019). The intermittent administration of ethanol during the juvenile period produces changes in the expression of hippocampal genes and proteins and deterioration of spatial memory. Behav. Brain Res.372, 112033. 10.1016/j.bbr.2019.112033
18
CoulterO. R.WalkerC. D.RisherM. L. (2023). Astrocyte-specific Ca(2+) activity: mechanisms of action, experimental tools, and roles in ethanol-induced dysfunction. Biochem. Cell Biol.101, 410–421. 10.1139/bcb-2023-0008
19
DavalosD.GrutzendlerJ.YangG.KimJ. V.ZuoY.JungS.et al (2005). ATP mediates rapid microglial response to local brain injury in vivo. Nat. Neurosci.8, 752–758. 10.1038/nn1472
20
De BockM.WangN.BolM.DecrockE.PonsaertsR.BultynckG.et al (2012). Connexin 43 hemichannels contribute to cytoplasmic Ca2+ oscillations by providing a bimodal Ca2+-dependent Ca2+ entry pathway. J. Biol. Chem.287, 12250–12266. 10.1074/jbc.M111.299610
21
DewitD. J.AdlafE. M.OffordD. R.OgborneA. C. (2000). Age at first alcohol use: a risk factor for the development of alcohol disorders. Am. J. Psychiatry157, 745–750. 10.1176/appi.ajp.157.5.745
22
D'hondtC.IyyathuraiJ.VinkenM.RogiersV.LeybaertL.HimpensB.et al (2013). Regulation of connexin- and pannexin-based channels by post-translational modifications. Biol. Cell105, 373–398. 10.1111/boc.201200096
23
DiamondI.GordonA. S. (1997). Cellular and molecular neuroscience of alcoholism. Physiol. Rev.77, 1–20. 10.1152/physrev.1997.77.1.1
24
DiazE. F.LabraV. C.AlvearT. F.MelladoL. A.InostrozaC. A.OyarzunJ. E.et al (2019). Connexin 43 hemichannels and pannexin-1 channels contribute to the α-synuclein-induced dysfunction and death of astrocytes. Glia67, 1598–1619. 10.1002/glia.23631
25
EsseltineJ. L.LairdD. W. (2016). Next-Generation connexin and pannexin cell Biology. Trends Cell Biol.26, 944–955. 10.1016/j.tcb.2016.06.003
26
FaddaF.RossettiZ. L. (1998). Chronic ethanol consumption: from neuroadaptation to neurodegeneration. Prog. Neurobiol.56, 385–431. 10.1016/s0301-0082(98)00032-x
27
FioriM. C.FigueroaV.ZoghbiM. E.SáezJ. C.ReussL.AltenbergG. A. (2012). Permeation of calcium through purified connexin 26 hemichannels. J. Biol. Chem.287, 40826–40834. 10.1074/jbc.M112.383281
28
GaeteP. S.ContrerasJ. E. (2020). Uncoupled permeation through large-pore channels: ions and molecules don't always ride together. J. Physiol.598, 209–210. 10.1113/JP279263
29
Gajardo-GómezR.SantibanezC. A.LabraV. C.GómezG. I.EugeninE. A.OrellanaJ. A. (2020). HIV gp120 protein increases the function of connexin 43 hemichannels and pannexin-1 channels in astrocytes: repercussions on astroglial function. Int. J. Mol. Sci.21, 2503. 10.3390/ijms21072503
30
GaricA.FlentkeG. R.AmbergerE.HernandezM.SmithS. M. (2011). CaMKII activation is a novel effector of alcohol's neurotoxicity in neural crest stem/progenitor cells. J. Neurochem.118, 646–657. 10.1111/j.1471-4159.2011.07273.x
31
GarréJ. M.YangG.BukauskasF. F.BennettM. V. (2016). FGF-1 triggers pannexin-1 hemichannel opening in spinal astrocytes of rodents and promotes inflammatory responses in acute spinal cord slices. J. Neurosci.36, 4785–4801. 10.1523/JNEUROSCI.4195-15.2016
32
GeorgeS.RogersR. D.DukaT. (2005). The acute effect of alcohol on decision making in social drinkers. Psychopharmacol. Berl.182, 160–169. 10.1007/s00213-005-0057-9
33
GhezaliG.VasileF.CurryN.FanthamM.CheungG.EzanP.et al (2020). Neuronal activity drives astroglial connexin 30 in perisynaptic processes and shapes its functions. Cereb. Cortex30, 753–766. 10.1093/cercor/bhz123
34
GiaumeC.LeybaertL.NausC. C.SaezJ. C. (2013). Connexin and pannexin hemichannels in brain glial cells: properties, pharmacology, and roles. Front. Pharmacol.4, 88. 10.3389/fphar.2013.00088
35
GiaumeC.NausC. C.SaezJ. C.LeybaertL. (2021). Glial connexins and pannexins in the healthy and diseased brain. Physiol. Rev.101, 93–145. 10.1152/physrev.00043.2018
36
GlobusM. Y.AlonsoO.DietrichW. D.BustoR.GinsbergM. D. (1995). Glutamate release and free radical production following brain injury: effects of posttraumatic hypothermia. J. Neurochem.65, 1704–1711. 10.1046/j.1471-4159.1995.65041704.x
37
GoenagaJ.AraqueA.KofujiP.Herrera Moro ChaoD. (2023). Calcium signaling in astrocytes and gliotransmitter release. Front. Synaptic Neurosci.15, 1138577. 10.3389/fnsyn.2023.1138577
38
GómezG. I.AlvearT. F.RoaD. A.Farias-PastenA.VergaraS. A.MelladoL. A.et al (2024). Cx43 hemichannels and panx1 channels contribute to ethanol-induced astrocyte dysfunction and damage. Biol. Res.57, 15. 10.1186/s40659-024-00493-2
39
GómezG. I.FalconR. V.MaturanaC. J.LabraV. C.SalgadoN.RojasC. A.et al (2018). Heavy alcohol exposure activates astroglial hemichannels and pannexons in the Hippocampus of adolescent rats: effects on neuroinflammation and astrocyte arborization. Front. Cell Neurosci.12, 472. 10.3389/fncel.2018.00472
40
GonzálezD.Gómez-HernandezJ. M.BarrioL. C. (2006). Species specificity of mammalian connexin-26 to form open voltage-gated hemichannels. FASEB J.20, 2329–2338. 10.1096/fj.06-5828com
41
GunnC.MackusM.GriffinC.MunafoM. R.AdamsS. (2018). A systematic review of the next-day effects of heavy alcohol consumption on cognitive performance. Addiction113, 2182–2193. 10.1111/add.14404
42
GuoA.ZhangH.LiH.ChiuA.García-RodríguezC.LagosC. F.et al (2022). Inhibition of connexin hemichannels alleviates neuroinflammation and hyperexcitability in temporal lobe epilepsy. Proc. Natl. Acad. Sci. U. S. A.119, e2213162119. 10.1073/pnas.2213162119
43
HansenD. B.BraunsteinT. H.NielsenM. S.MacaulayN. (2014a). Distinct permeation profiles of the connexin 30 and 43 hemichannels. FEBS Lett.588, 1446–1457. 10.1016/j.febslet.2014.01.036
44
HansenD. B.YeZ. C.CalloeK.BraunsteinT. H.HofgaardJ. P.RansomB. R.et al (2014b). Activation, permeability, and inhibition of astrocytic and neuronal large pore (hemi)channels. J. Biol. Chem.289, 26058–26073. 10.1074/jbc.M114.582155
45
HarchaP. A.LópezX.SáezP. J.FernandezP.BarriaI.MartinezA. D.et al (2019). Pannexin-1 channels are essential for mast cell degranulation triggered during type I hypersensitivity reactions. Front. Immunol.10, 2703. 10.3389/fimmu.2019.02703
46
HongS. I.KangS.BakerM.ChoiD. S. (2021). Astrocyte-neuron interaction in the dorsal striatum-pallidal circuits and alcohol-seeking behaviors. Neuropharmacology198, 108759. 10.1016/j.neuropharm.2021.108759
47
HuZ.RiquelmeM. A.GuS.JiangJ. X. (2020). Regulation of connexin gap junctions and hemichannels by calcium and calcium binding protein calmodulin. Int. J. Mol. Sci.21, 8194. 10.3390/ijms21218194
48
IglesiasR.DahlG.QiuF.SprayD. C.ScemesE. (2009). Pannexin 1: the molecular substrate of astrocyte "hemichannels. J. Neurosci.29, 7092–7097. 10.1523/JNEUROSCI.6062-08.2009
49
IyyathuraiJ.D'hondtC.WangN.De BockM.HimpensB.RetamalM. A.et al (2013). Peptides and peptide-derived molecules targeting the intracellular domains of Cx43: gap junctions versus hemichannels. Neuropharmacology75, 491–505. 10.1016/j.neuropharm.2013.04.050
50
JohnsonR. G.LeH. C.EvensonK.LobergS. W.MyslajekT. M.PrabhuA.et al (2016). Connexin hemichannels: methods for dye uptake and leakage. J. Membr. Biol.249, 713–741. 10.1007/s00232-016-9925-y
51
JungY. C.NamkoongK. (2014). Alcohol: intoxication and poisoning - diagnosis and treatment. Handb. Clin. Neurol.125, 115–121. 10.1016/B978-0-444-62619-6.00007-0
52
KimH. B.LuY.OhS. C.MorrisJ.MiyashiroK.KimJ.et al (2022). Astrocyte ethanol exposure reveals persistent and defined calcium response subtypes and associated gene signatures. J. Biol. Chem.298, 102147. 10.1016/j.jbc.2022.102147
53
KimH. B.MorrisJ.MiyashiroK.LehtoT.LangelU.EberwineJ.et al (2021). Astrocytes promote ethanol-induced enhancement of intracellular Ca(2+) signals through intercellular communication with neurons. iScience24, 102436. 10.1016/j.isci.2021.102436
54
KimelbergH. K.CheemaM.O'connorE. R.TongH.GoderieS. K.RossmanP. A. (1993). Ethanol-induced aspartate and taurine release from primary astrocyte cultures. J. Neurochem.60, 1682–1689. 10.1111/j.1471-4159.1993.tb13391.x
55
LeeN. S.YoonC. W.WangQ.MoonS.KooK. M.JungH.et al (2020). Focused ultrasound stimulates ER localized mechanosensitive PANNEXIN-1 to mediate intracellular calcium release in invasive cancer cells. Front. Cell Dev. Biol.8, 504. 10.3389/fcell.2020.00504
56
LeoneR. M.ParrottD. J. (2019). Acute alcohol intoxication inhibits bystander intervention behavior for sexual aggression among men with high intent to help. Alcohol Clin. Exp. Res.43, 170–179. 10.1111/acer.13920
57
LinsambarthS.CarvajalF. J.Moraga-AmaroR.MendezL.TamburiniG.JimenezI.et al (2022). Astroglial gliotransmitters released via Cx43 hemichannels regulate NMDAR-dependent transmission and short-term fear memory in the basolateral amygdala. FASEB J.36, e22134. 10.1096/fj.202100798RR
58
LocoveiS.WangJ.DahlG. (2006). Activation of pannexin 1 channels by ATP through P2Y receptors and by cytoplasmic calcium. FEBS Lett.580, 239–244. 10.1016/j.febslet.2005.12.004
59
LópezX.Palacios-PradoN.GuizaJ.EscamillaR.FernandezP.VegaJ. L.et al (2021). A physiologic rise in cytoplasmic calcium ion signal increases pannexin1 channel activity via a C-terminus phosphorylation by CaMKII. Proc. Natl. Acad. Sci. U. S. A.118, e2108967118. 10.1073/pnas.2108967118
60
MassaA. A.SubramaniO. S.EckhardtC. I.ParrottD. J. (2019). Problematic alcohol use and acute intoxication predict anger-related attentional biases: a test of the alcohol myopia theory. Psychol. Addict. Behav.33, 139–143. 10.1037/adb0000426
61
MelaniA.TurchiD.VannucchiM. G.CiprianiS.GianfriddoM.PedataF. (2005). ATP extracellular concentrations are increased in the rat striatum during in vivo ischemia. Neurochem. Int.47, 442–448. 10.1016/j.neuint.2005.05.014
62
MeunierC.WangN.YiC.DalleracG.EzanP.KoulakoffA.et al (2017). Contribution of astroglial Cx43 hemichannels to the modulation of glutamatergic currents by D-serine in the mouse prefrontal cortex. J. Neurosci.37, 9064–9075. 10.1523/JNEUROSCI.2204-16.2017
63
MonteroT. D.OrellanaJ. A. (2015). Hemichannels: new pathways for gliotransmitter release. Neuroscience286, 45–59. 10.1016/j.neuroscience.2014.11.048
64
MoreanM. E.KongG.CamengaD. R.CavalloD. A.ConnellC.Krishnan-SarinS. (2014). First drink to first drunk: age of onset and delay to intoxication are associated with adolescent alcohol use and binge drinking. Alcohol Clin. Exp. Res.38, 2615–2621. 10.1111/acer.12526
65
MotschmanC. A.HatzL. E.MccartyK. N.MerkleE. C.TrullT. J.MccarthyD. M. (2020). Event-level predictors of alcohol-impaired driving intentions. J. Stud. Alcohol Drugs81, 647–654. 10.15288/jsad.2020.81.647
66
NagyJ. I.IonescuA. V.LynnB. D.RashJ. E. (2003). Coupling of astrocyte connexins Cx26, Cx30, Cx43 to oligodendrocyte Cx29, Cx32, Cx47: implications from normal and connexin32 knockout mice. Glia44, 205–218. 10.1002/glia.10278
67
NielsenB. S.AlstromJ. S.NicholsonB. J.NielsenM. S.MacaulayN. (2017). Permeant-specific gating of connexin 30 hemichannels. J. Biol. Chem.292, 19999–20009. 10.1074/jbc.M117.805986
68
NishizawaY. (2001). Glutamate release and neuronal damage in ischemia. Life Sci.69, 369–381. 10.1016/s0024-3205(01)01142-0
69
OrellanaJ. A.RetamalM. A.Moraga-AmaroR.StehbergJ. (2016). Role of astroglial hemichannels and pannexons in memory and neurodegenerative diseases. Front. Integr. Neurosci.10, 26. 10.3389/fnint.2016.00026
70
ParadaM.CorralM.Caamano-IsornaF.MotaN.CregoA.HolguinS. R.et al (2011). Binge drinking and declarative memory in university students. Alcohol Clin. Exp. Res.35, 1475–1484. 10.1111/j.1530-0277.2011.01484.x
71
PatelD.ZhangX.VeenstraR. D. (2014). Connexin hemichannel and pannexin channel electrophysiology: how do they differ?FEBS Lett.588, 1372–1378. 10.1016/j.febslet.2013.12.023
72
PaulD. L.EbiharaL.TakemotoL. J.SwensonK. I.GoodenoughD. A. (1991). Connexin46, a novel lens gap junction protein, induces voltage-gated currents in nonjunctional plasma membrane of Xenopus oocytes. J. Cell Biol.115, 1077–1089. 10.1083/jcb.115.4.1077
73
PelegrinP.SurprenantA. (2006). Pannexin-1 mediates large pore formation and interleukin-1beta release by the ATP-gated P2X7 receptor. EMBO J.25, 5071–5082. 10.1038/sj.emboj.7601378
74
RippsH.QianH.ZakeviciusJ. (2004). Properties of connexin26 hemichannels expressed in Xenopus oocytes. Cell Mol. Neurobiol.24, 647–665. 10.1023/b:cemn.0000036403.43484.3d
75
SáezJ. C.VargasA. A.HernandezD. E.OrtizF. C.GiaumeC.OrellanaJ. A. (2020). Permeation of molecules through astroglial connexin 43 hemichannels is modulated by cytokines with parameters depending on the permeant species. Int. J. Mol. Sci.21, 3970. 10.3390/ijms21113970
76
SalasD.PueblaC.LampeP. D.LavanderoS.SáezJ. C. (2015). Role of Akt and Ca2+ on cell permeabilization via connexin43 hemichannels induced by metabolic inhibition. Biochim. Biophys. Acta1852, 1268–1277. 10.1016/j.bbadis.2015.03.004
77
SalazarM.ParienteJ. A.SalidoG. M.GonzálezA. (2008). Ethanol induces glutamate secretion by Ca2+ mobilization and ROS generation in rat hippocampal astrocytes. Neurochem. Int.52, 1061–1067. 10.1016/j.neuint.2007.11.001
78
SamsonH. H.HarrisR. A. (1992). Neurobiology of alcohol abuse. Trends Pharmacol. Sci.13, 206–211. 10.1016/0165-6147(92)90065-e
79
SchalperK. A.SanchezH. A.LeeS. C.AltenbergG. A.NathansonM. H.SaezJ. C. (2010). Connexin 43 hemichannels mediate the Ca2+ influx induced by extracellular alkalinization. Am. J. Physiol. Cell Physiol.299, C1504–C1515. 10.1152/ajpcell.00015.2010
80
SilvermanW.LocoveiS.DahlG. (2008). Probenecid, a gout remedy, inhibits pannexin 1 channels. Am. J. Physiol. Cell Physiol.295, C761–C767. 10.1152/ajpcell.00227.2008
81
Silvestre De FerronB.BennouarK. E.KervernM.Alaux-CantinS.RobertA.RabiantK.et al (2015). Two binges of ethanol a day keep the memory away in adolescent rats: key role for GLUN2B subunit. Int. J. Neuropsychopharmacol.19, pyv087. 10.1093/ijnp/pyv087
82
SyrjanenJ.MichalskiK.KawateT.FurukawaH. (2021). On the molecular nature of large-pore channels. J. Mol. Biol.433, 166994. 10.1016/j.jmb.2021.166994
83
VasileF.DossiE.MoulardJ.EzanP.LecoinL.Cohen-SalmonM.et al (2022). Pannexin 1 activity in astroglia sets hippocampal neuronal network patterns. PLoS Biol.20, e3001891. 10.1371/journal.pbio.3001891
84
VerkhratskyA.NedergaardM. (2018). Physiology of astroglia. Physiol. Rev.98, 239–389. 10.1152/physrev.00042.2016
85
VolterraA.LiaudetN.SavtchoukI. (2014). Astrocyte Ca²⁺ signalling: an unexpected complexity. Nat. Rev. Neurosci.15, 327–335. 10.1038/nrn3725
86
VonghiaL.LeggioL.FerrulliA.BertiniM.GasbarriniG.AddoloratoG.et al (2008). Acute alcohol intoxication. Eur. J. Intern Med.19, 561–567. 10.1016/j.ejim.2007.06.033
87
WalterH. J.MessingR. O. (1999). Regulation of neuronal voltage-gated calcium channels by ethanol. Neurochem. Int.35, 95–101. 10.1016/s0197-0186(99)00050-9
88
WeberB.BarrosL. F. (2015). The astrocyte: powerhouse and recycling center. Cold Spring Harb. Perspect. Biol.7, a020396. 10.1101/cshperspect.a020396
89
WhelanR.WattsR.OrrC. A.AlthoffR. R.ArtigesE.BanaschewskiT.et al (2014). Neuropsychosocial profiles of current and future adolescent alcohol misusers. Nature512, 185–189. 10.1038/nature13402
90
WhiteA. M. (2003). What happened? Alcohol, memory blackouts, and the brain. Alcohol Res. Health27, 186–196.
91
WieraszkoA.SeyfriedT. N. (1989). Increased amount of extracellular ATP in stimulated hippocampal slices of seizure prone mice. Neurosci. Lett.106, 287–293. 10.1016/0304-3940(89)90178-x
92
XuJ.NicholsonB. J. (2023). Divergence between hemichannel and gap junction permeabilities of connexin 30 and 26. Life (Basel)13, 390. 10.3390/life13020390
93
YangY.DelalioL. J.BestA. K.MacalE.MilsteinJ.DonnellyI.et al (2020). Endothelial pannexin 1 channels control inflammation by regulating intracellular calcium. J. Immunol.204, 2995–3007. 10.4049/jimmunol.1901089
Summary
Keywords
alcoholism, connexins, pannexins, glia, hemichannels, connexin 43, pannexin-1
Citation
Gómez GI, García-Rodríguez C, Marillán JE, Vergara SA, Alvear TF, Farias-Pasten A, Sáez JC, Retamal MA, Rovegno M, Ortiz FC and Orellana JA (2024) Acute activation of hemichannels by ethanol leads to Ca2+-dependent gliotransmitter release in astrocytes. Front. Cell Dev. Biol. 12:1422978. doi: 10.3389/fcell.2024.1422978
Received
25 April 2024
Accepted
30 May 2024
Published
21 June 2024
Volume
12 - 2024
Edited by
Roberto Bruzzone, Institut Pasteur, France
Reviewed by
Peter Brink, Stony Brook University, United States
Anaclet Ngezahayo, Leibniz University Hannover, Germany
Updates
Copyright
© 2024 Gómez, García-Rodríguez, Marillán, Vergara, Alvear, Farias-Pasten, Sáez, Retamal, Rovegno, Ortiz and Orellana.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Juan A. Orellana, jaorella@uc.cl; Fernando C. Ortiz, fernando.ortiz.c@usach.cl; Maximiliano Rovegno, maxrovegno@uc.cl
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.