ORIGINAL RESEARCH article

Front. Cell Dev. Biol., 23 October 2023

Sec. Nuclear Organization and Dynamics

Volume 11 - 2023 | https://doi.org/10.3389/fcell.2023.1240285

Native lamin A/C proteomes and novel partners from heart and skeletal muscle in a mouse chronic inflammation model of human frailty

  • 1. Department of Cell Biology, Johns Hopkins University School of Medicine, Baltimore, MD, United States

  • 2. Department of Biological Chemistry, Johns Hopkins University School of Medicine, Baltimore, MD, United States

  • 3. Division of Geriatric Medicine and Gerontology, Johns Hopkins University School of Medicine, Baltimore, MD, United States

Abstract

Clinical frailty affects ∼10% of people over age 65 and is studied in a chronically inflamed (Interleukin-10 knockout; “IL10-KO”) mouse model. Frailty phenotypes overlap the spectrum of diseases (“laminopathies”) caused by mutations in LMNA. LMNA encodes nuclear intermediate filament proteins lamin A and lamin C (“lamin A/C”), important for tissue-specific signaling, metabolism and chromatin regulation. We hypothesized that wildtype lamin A/C associations with tissue-specific partners are perturbed by chronic inflammation, potentially contributing to dysfunction in frailty. To test this idea we immunoprecipitated native lamin A/C and associated proteins from skeletal muscle, hearts and brains of old (21–22 months) IL10-KO versus control C57Bl/6 female mice, and labeled with Tandem Mass Tags for identification and quantitation by mass spectrometry. We identified 502 candidate lamin-binding proteins from skeletal muscle, and 340 from heart, including 62 proteins identified in both tissues. Candidates included frailty phenotype-relevant proteins Perm1 and Fam210a, and nuclear membrane protein Tmem38a, required for muscle-specific genome organization. These and most other candidates were unaffected by IL10-KO, but still important as potential lamin A/C-binding proteins in native heart or muscle. A subset of candidates (21 in skeletal muscle, 30 in heart) showed significantly different lamin A/C-association in an IL10-KO tissue (p < 0.05), including AldoA and Gins3 affected in heart, and Lmcd1 and Fabp4 affected in skeletal muscle. To screen for binding, eleven candidates plus prelamin A and emerin controls were arrayed as synthetic 20-mer peptides (7-residue stagger) and incubated with recombinant purified lamin A “tail” residues 385–646 under relatively stringent conditions. We detected strong lamin A binding to peptides solvent exposed in Lmcd1, AldoA, Perm1, and Tmem38a, and plausible binding to Csrp3 (muscle LIM protein). These results validated both proteomes as sources for native lamin A/C-binding proteins in heart and muscle, identified four candidate genes for Emery-Dreifuss muscular dystrophy (CSRP3, LMCD1, ALDOA, and PERM1), support a lamin A-interactive molecular role for Tmem38A, and supported the hypothesis that lamin A/C interactions with at least two partners (AldoA in heart, transcription factor Lmcd1 in muscle) are altered in the IL10-KO model of frailty.

Introduction

Clinical frailty affects ∼10% of people over age 65 and associates with disproportionately high rates of morbidity and mortality (Morley et al., 2013). Diagnosis is based on a spectrum of phenotypes, measured by a Frailty Index score, that can include reduced hand-grip strength, slowed walking, exercise intolerance, unexplained weight loss, reduced cognition or other diagnostic features (Lewsey et al., 2020; Xue et al., 2020). Because clinical frailty also strongly correlates with chronic inflammation, it is studied in a C57Bl/6 mouse model genetically deficient for the anti-inflammatory cytokine, Interleukin-10 (IL-10 B6.129P2-IL 10tm/tm/J mice; Walston et al., 2008). These IL10tm/tm (henceforth ‘IL10-KO’) mice experience lifelong chronic inflammation and exhibit multiple phenotypes consistent with human frailty including increased expression of NF-kB-dependent inflammatory mediators (e.g., IL-1β, TNFα, IFγ, IL-6, chemokine ligand-1; Walston et al., 2008; Ma et al., 2021) as well as age-associated reductions in strength, altered skeletal muscle gene expression, altered insulin signaling (high IGF-1), impaired mitochondrial degradation, high blood pressure, vascular stiffness, reduced fat, endothelial dysfunction, dysregulated tyrosine degradation and higher mortality (Sikka et al., 2013; Westbrook et al., 2017; Lewsey et al., 2020; Malinina et al., 2020; Westbrook et al., 2020). Though primarily a model for chronic inflammation, IL10-KO mice are valuable for many purposes including the study of frailty. There may be other pathways that also lead to frailty that were not investigated here.

Muscle weakening and metabolic disorders are also characteristic of the spectrum of diseases caused by mutations in LMNA (“laminopathies”; Charar and Gruenbaum, 2017; Brull et al., 2018; Kreienkamp and Gonzalo, 2020). LMNA encodes two abundant nuclear intermediate filament proteins named lamin A and lamin C. Each self-polymerizes, forming lamin A filaments and lamin C filaments in the nucleus. These filaments and two others (lamin B1 and lamin B2) interact with nuclear membrane proteins and chromatin to form nuclear “lamina” networks collectively responsible for nuclear structure, genome integrity, tissue-specific 3D genome organization and tissue-specific gene regulation (Simon and Wilson, 2011; de Las Heras et al., 2013; Zuleger et al., 2013; Harr et al., 2015; van Steensel and Belmont, 2017). Mutations in LMNA cause over 15 genetically-dominant disorders including Emery-Dreifuss muscular dystrophy, cardiomyopathy, lipodystrophy, neuropathy, insulin resistance, “accelerated aging” disorders (e.g., Hutchinson-Gilford Progeria (Brull et al., 2018) and juvenile idiopathic inflammatory myopathy (Moraitis et al., 2015); see the Universal Mutations Database (http://www.umd.be/LMNA/). LMNA mutations are also reported in ∼11% of ‘metabolic syndrome’ patients (Decaudain et al., 2007; Dutour et al., 2011; Desgrouas et al., 2020), 10% of dilated cardiomyopathy patients (Captur et al., 2018) and 27% of heart transplant patients (Kayvanpour et al., 2017).

LMNA missense mutations are too rare (less than 1%) in large populations (Florwick et al., 2017) to account for the staggering prevalence of clinical frailty. However, given their upstream roles in signaling and gene regulation, anything that perturbs lamins or their interactions has the potential to disrupt tissue-specific functions, especially in striated muscle. For example, reduced expression of lamin A/C protein associates with osteosarcopenia in human frailty, as measured in circulating osteoprogenitor cells (Al Saedi et al., 2018); similarly, reduced lamin A/C expression in mice due to haploinsufficiency correlates with reduced anabolic response to exercise (Duque et al., 2011). Conversely, increased expression of lamin A/C mRNA and protein, seen in adipose tissue macrophages, is proposed to contribute to obesity-induced insulin resistance by affecting NF-kB signaling in myeloid cells (Kim et al., 2018). Inflammatory signaling is mediated by phosphorylation or O-GlcNAcylation of many proteins (Hart, 2014; Li et al., 2019), with the potential to influence lamins A/C (Simon et al., 2018; Lin et al., 2020; Zheng et al., 2022) or partners important for tissue-specific signaling, genome organization or gene expression (Worman and Schirmer, 2015; Wong et al., 2021a). The mechanisms of laminopathies and their hypothetical relationship to human frailty mechanisms are largely unknown due to a lack of knowledge about lamin-dependent proteins in affected tissues such as heart.

We hypothesized that chronic inflammation alters lamin A/C interactions with frailty-relevant partners in muscle, heart or brain. Native lamin A/C proteomes have been reported to our knowledge in only two tissues: postmortem human muscle and adipose (Bar et al., 2018). A pioneering biochemical strategy to purify and identify nuclear membrane proteins from native tissues yielded hundreds of novel proteins (Schirmer et al., 2003; Wong et al., 2014), with the potential to bind A- or B-type lamins. Most knowledge about lamin A/C proteomes is based on three approaches: a) proximity labeling (Bosch et al., 2021) in engineered cultured cells such as HEK293 cells (Roux et al., 2012; Go et al., 2021) or fibroblasts (Xie et al., 2016; Chojnowski et al., 2018), b) high throughput screening of candidate proteins (Dittmer et al., 2014) and c) biochemical strategies including lamin A-affinity purification of proteins from either C2C12 myotubes (Depreux et al., 2015), cardiac myocyte (NklTAg) cells or mouse embryonic fibroblasts [Kubben et al., 2010; reviewed by Simon and Wilson (2013)]. Our challenge was therefore two-fold: firstly, to identify lamin A/C proteomes in frailty-relevant native tissues, and secondly, to determine which (if any) associations changed in IL10-KO mice. To test the hypothesis, we immunoprecipitated native lamins A/C and associated proteins from three native tissues in aged (21–22 months old) female mice—heart and skeletal muscle (reported here) and brain (reported separately)—and used Tandem Mass Tags to quantify and compare results from control (C57Bl/6) versus IL10-KO mice. After normalizing to the amount of lamin A/C in each sample, most identified proteins were unaffected by IL10-KO, as expected. However, a subset of identified proteins showed differential lamin A/C-association in IL10-KO tissue, relative to controls. Selected candidates-of-interest were displayed as staggered 20-mer synthetic peptides and probed with recombinant lamin A, to screen for direct binding. Results for seven candidates, and molecular mapping of lamin-binding regions, unexpectedly revealed that four new partners (Csrp3, Lmcd1, AldoA, and Perm1) share a proposed lamin-binding motif.

Materials and methods

Mouse care and tissue harvest

Female wildtype (WT) C57Bl/6 and IL10-KO (B6.129P2-IL10tm1Cgn/J) mice were purchased from Jackson Laboratory (Bar Harbor, ME; National Institute on Aging, Bethesda, MD) and housed under specific pathogen-free barrier conditions until the age of 21–22 months in facilities accredited by the Association for Assessment and Accreditation of Laboratory Animal Care International. Nineteen mice (eleven IL10-KO and eight WT) were euthanized by administered inhalation anesthesia in a plastic chamber under a vented hood using gauze soaked in pharmaceutical-grade isoflurane, followed by cervical dislocation once the mouse was unconscious. Death was verified by observed cessation of breathing and heartbeat. Tissues were harvested, weighed, flash-frozen in liquid nitrogen and stored at −80°C as described (Sikka et al., 2013; Malinina et al., 2020). All protocols were approved by the Johns Hopkins University Institutional Animal Care and Use Committee, and all experiments performed accordingly.

Tissue lysates, immunoprecipitation and Western blotting

Frozen tissues were each pulverized under liquid nitrogen using a pre-chilled mortar and pestle, and powdered tissue was stored at −80C or in liquid nitrogen until use. To prepare lysates, we added powdered tissue (80–100 mg) to 500 uL ice-cold lysis buffer (50 mM Tris-HCl pH 7.4, 300 mM NaCl, 0.3% v/v Triton-X100, 5 mM EDTA, 1 mM DTT, 100 uM PMSF, 1 ug/mL Pepstatin A, 1X Thermo Scientific Halt Protease Inhibitor Cocktail #78430, 50 nM Thiamet G [OGA inhibitor; 1,2-dideoxy-2′-ethylamino-α-d-glucopyranoso-[2,1-d]-Δ2′-thiazoline; provided by G. W. Hart) and 50 mM UDP-GlcNAc [Sigma]) in a 2 mL Eppendorf tube on ice, and moved to liquid nitrogen as needed to keep frozen until further processing. Thiamet G and UDP-GlcNAc were included to maintain labile O-GlcNAc modifications. Samples were flick-vortexed to mix, incubated 10 min on ice, vortexed 10 s at high speed, then sonicated on ice 20 times (0.5 s bursts) and finally centrifuged 30 min (16,000 g, 4°C) to pellet insoluble material. Sonication greatly facilitates solubilization of lamins and associated proteins (Berk et al., 2013; Berk and Wilson, 2016). Supernatant protein concentrations were measured via Bradford assay and adjusted with lysis buffer to 1 ug/uL before use.

Immunoprecipitation

For each preparatory immunoprecipitation, 500 uL lysate (500 ug total protein) was incubated with 10 uL anti-lamin A/C mouse mAb 4C11 (Cell Signaling Technologies #4777; 1:50 dilution) with rotation overnight at 4°C. We then added 10 uL Protein G Sepharose slurry (GE Healthcare #17-0618-01, prewashed three times in 300 uL lysis buffer) to each reaction and rotated 1 h at 4°C. After pelleting (1 min, 13,300 g, 4°C), the beads were washed three times in 300 uL lysis buffer. For mass spectrometry analysis, bound proteins from each sample were eluted using 50 uL 1% SDS. Alternatively, for SDS-PAGE and Western blotting of smaller scale immunoprecipitations, bound proteins were eluted by heating (95°C) for 5 min in 30 uL of 2x SDS-sample buffer.

Analytical SDS-PAGE and Western blots of heart immunoprecipitates

Immunoprecipitates (20 uL each; corresponding to 40 ug input lysate protein) were resolved on Bolt 8% Bis-Tris Plus gels in MOPS running buffer for 5 min at 200 V (20°C–22°C), then at 170 V for 1.5 h (4°C). Resolved proteins were transferred to nitrocellulose membranes for 1.5 h at 300 mA, at 4°C. Membranes were blocked 1 h in blocking buffer (3% BSA, 0.01% Tween-20, 20 mM Tris Base, 137 mM NaCl, pH 7.6). The primary antibody, which specifically recognizes the O-GlcNAc modification (IgM mAb CTD110.6, Santa Cruz Biotechnologies, 1:1000; provided by Natasha Zachara) was first diluted into blocking buffer. Blots were then rocked overnight (4°C), washed three times with TBST buffer (0.01% Tween-20, 20 mM Tris Base, 137 mM NaCl, pH 7.6), incubated (1 h at 20°C–22°C) with secondary antibody (HRP-conjugated anti-mouse IgM; Santa Cruz Biotechnology #sc-2064; dilution 1:10,000) in blocking buffer, washed three times in TBST, and finally visualized by enhanced chemiluminescence (Hyblot CL autoradiography film #E3012).

To detect bound lamin proteins, we next incubated with lamin A/C antibodies. Blots were not allowed to dry; each blot was stripped for 10 min in stripping buffer (1.5% w/v glycine, 0.1% w/v SDS, 1% v/v Tween-20, pH 2.2), washed twice (10 min each) in PBS (16 mM Na2HPO4, 3 mM KH2PO4, 270 mM NaCl, 5.4 mM KCl, pH 7.4) and twice (5 min each) in TBST. Blots were then blocked 1 h at 20°C–22°C using 3% BSA in TBST, incubated with lamin A/C antibodies (sc-20861 rAb, Santa Crus Biotechnologies, 1:1000 in blocking buffer) overnight at 4°C, then incubated with secondary antibody (HRP-conjugated anti-rabbit IgG; Cell Signaling Technologies #7074S; dilution 1:10,000), washed, and visualized by enhanced chemiluminescence (Hyblot CL autoradiography film #E3012). Films were scanned with the Epson Perfection V500 Photo scanner. Western blot signals were quantified via Quantity One, version 4.6.9.

Tandem mass tag (TMT) proteomics

Protein extracts (40 ug total at 1 ug/ul in 1% SDS) were reduced with 15 uL of 15 mM DTT for 1 h at 56°C, alkylated by adding 15 uL 100 mM iodoacetamide and incubating in the dark for 30 min, and then TCA/Acetone precipitated. The protein pellet from each sample was digested overnight at 37°C by adding 100 uL Trypsin/LysC mixture [40 ug proteases in 1.2 mL of 100 mM triethylammonium bicarbonate (TEAB; Promega #V5071) or approximately 3.33 ug protease per sample]. Individual samples (40 ug) were labeled with a unique isobaric mass tag reagent (TMT 10-plex, Thermo Scientific) according to manufacturer instructions. Both pairing and labeling order of TMT reagent and peptide sample were randomized. Briefly, the TMT reagents (0.8 ug vials) were allowed to come to room temperature before adding 41 uL anhydrous acetonitrile, then vortexed and centrifuged. The entire TMT reagent vial was added to the 100 ug peptide sample and reacted at room temperature for 1 h. The reaction was quenched by adding hydroxylamine (8 uL) to a final concentration of 5%. All TMT-labeled samples were combined and vacuum centrifuged to dryness removing the entire liquid.

Basic reverse phase (bRP) fractionation

Labeled peptide samples were fractionated by basic reverse phase (bRP) chromatography on Oasis HLB uElution plates (Waters). TMT labeled peptides (5%, approximately 20 ug) were bound to HLB resin in 10 mM triethylammonium bicarbonate (TEAB) buffer and step eluted with 0%, 5%, 10%, 25%, and 75% acetonitrile in 10 mM TEAB (0% and 5% fractions were combined). Fractions were dried by vacuum centrifugation.

Mass spectrometry analysis

The peptide fractions were resuspended in 20 uL 2% acetonitrile in 0.1% formic acid; approximately 0.5 ug (2 uL) was loaded onto a C18 trap (S-10 uM, 120 Å, 75 um × 2 cm; YMC Co., LTD., Kyoto, Japan) and then separated on an in-house packed PicoFrit column (75 um × 200 mm, 15 um, ±1 um tip, New Objective) with C18 phase (ReproSil-Pur C18-AQ, 3 um, 120 Å, www.dr-maisch.com) using 2%–90% acetonitrile gradient at 300 nL/min over 120 min on a EasyLC nanoLC 1000 (Thermo Scientific). Eluting peptides were sprayed at 2.0 kV directly into an Orbitrap Fusion Lumos (Thermo Scientific) mass spectrometer. Survey scans (full ms) were acquired from 360–1,700 m/z with a cycle time of 3 s. Precursor ions isolated in a 0.7 Da window and fragmented using HCD activation collision energy 39 and 15 s dynamic exclusion, with a scan range of 116 m/z–2,000 m/z. Precursor and fragment ions were analyzed at resolutions 120,000 and 30,000, respectively, with automatic gain control (AGC) target values at 4 × 105 with 50 ms maximum injection time (IT) and 1 × 105 with 118 ms maximum IT, respectively.

Data analysis

Isotopically resolved masses in precursor (MS) and fragmentation (MS/MS) spectra were extracted from raw MS data using spectrum selector with recalibration in Proteome Discoverer (PD) software (version 2.4.0.305, Thermo Scientific) and searched using Mascot (2.6.2; www.matrixscience.com) against a Mus musculus protein database (RefSeq 2017_83, created 5/23/2019, containing 76,508 sequences. The following criteria were set for all database searches: 1) all species in database; 2) trypsin as the enzyme, 3) two missed cleavages allowed; 4) N-terminal TMT6plex and cysteine carbamidomethylation as fixed modifications; 5) lysine TMT6plex, methionine oxidation, serine, threonine and tyrosine phosphorylation, asparagine and glutamine deamidation, HexNAc on serine or threonine, as variable modifications; and 6) precursor and fragment ion tolerances were set to 5 ppm and 0.03 Da, respectively. Peptide identifications from Mascot searches were filtered at 5% False Discovery Rate (FDR) confidence threshold, based on a concatenated decoy database search, using the Proteome Discoverer. Proteome Discoverer uses only the peptide identifications with the highest Mascot score for the same peptide matched spectrum from the different extraction methods. The protein intensities were reported as S/N of each peptide and relative protein comparisons were calculated using the peptide grouping in Proteome Discoverer. Quan value correction factors were used (Lot TK271715) with a co-isolation threshold of 30. Peptide abundances were normalized against a custom sequence.FASTA file containing only prelamin A [XP_006501136.1 PREDICTED: prelamin-A/C isoform X1 (Mus musculus)] to ensure there was no experimental bias in protein quantification that depended on the total amount of lamin A/C immunoprecipitated from each sample.

Statistical analysis, filtering and curation of proteomic data

Data were analyzed using R version 4.0.4 and all new bioinformatics and statistical analyses described here are available (GitHub repository: https://github.com/aditharun/frailty-laminome). To assess potential differences between the IL10-KO and WT proteomes in heart or muscle, we used a rigorous statistical method developed by Rucinski and others to detect significant changes in protein abundance (Kammers et al., 2015). Starting from the raw peptide spectra data, we removed proteins with an Isolation Interference greater than 30% or which had missing values, yielding Supplementary Table S1. We then normalized the abundances to the lamin A abundance in each channel (i.e., the same sample), and performed a two-sample Student’s t-test using an empirical Bayes method (R script: https://github.com/aditharun/frailty-laminome/blob/main/code/analysis.R). This script produces output spreadsheets that can either include all proteins (Supplementary Table S2), or a subset that excludes as presumed contaminants mitochondrial, ribosomal and keratin proteins. For downstream analysis and succinct reference, we developed a script that matches protein accession numbers with gene names (https://github.com/aditharun/frailty-laminome/blob/main/code/get_gene_names.R) from NCBI (https://www.ncbi.nlm.nih.gov/gene) using the R API for the NCBI Database and searching for the accession number of a particular protein to return a unique identifying number. This number was then matched, also using the NCBI API, to a specific gene name (Supplementary Table S3). Some gene names were unavailable and curated manually in the final table (Supplementary Table S4), which was also curated manually (non-exhaustively) to indicate reported nuclear envelope transmembrane proteins [“NETs”; (Malik et al., 2010)] and nuclear-localized proteins.

The scripts used for volcano plots are available here: https://github.com/aditharun/frailty-laminome/blob/main/code/volcano-stratification.R.

Peptide array synthesis and probing

Three identical custom peptide arrays were synthesized and printed on cellulose membranes by the Biopolymers and Proteomics Core Facility at the Koch Institute Swanson Biotechnology Center at Massachusetts Institute of Technology (Cambridge MA) as described (Frank and Dübel, 2005), using a Multipep automated peptide synthesizer (INTAVIS Bioanalytical Instruments AG, Koeln, Germany) as described (Frank and Overwin, 1996). The following proteins, all human, were each displayed as synthetic 20-mer peptides with seven amino acid offsets: Fabp4 (132 residues; NP_001433.1), Gins3 (216 residues; NP_073607.2), Perm1 (790 residues; NP_001356826.1), Tmem38a (299 residues; NP_076979.1), AldoA (364 residues; NP_908930.1), Csrp3 (194 residues; P50461-1), Lmcd1 (365 residues; Q9NZU5-1), emerin (254 residues; NP_000108.1), plus other proteins reported separately.

Arrays were incubated with C-terminally His-tagged residues 385–646 of human mature lamin A, affinity-purified from E. coli lysates. Protein expression was induced using 1 mM isopropyl-β-D-thio-galactoside (IPTG; 3 h, 37°C), and His-tagged polypeptides were affinity-purified as described (Simon et al., 2010), using Cobalt-charged TALON® metal ion affinity resin (Takara Bio United States, #635502).

Peptide arrays were probed as follows, at room temperature (20°C–22°C) unless otherwise noted. After initial wetting (∼5 min in methanol), each array was washed three times in TBS (pH 7.0) in a polystyrene plate, and then incubated overnight in Membrane Blocking Solution (MBS), made by mixing 20 mL concentrated Casein blocking buffer (Sigma-Genosys #SU-07-250) with 80 mL TBS-T [Tris-Buffered Saline (150 mM NaCl, 20 mM Tris) plus 0.05% (vol/vol) Tween 20; pH 8.0] and 5 g sucrose, then adjusting dropwise with NaOH to final pH 7.0. The arrays were washed twice in TBS-T, then incubated 3 h in 30 mL MBS containing 150 ug recombinant lamin tail protein (final lamin concentration, 190 nM). After two washes in TBS-T, arrays were incubated 1 h in MBS containing 20 uL anti-lamin A/C mouse clone 14 (Millipore Sigma #05-714; 1:1000 dilution), washed twice in TBST and incubated 1 h in MBS containing 6 uL AP-conjugated donkey anti-mouse (Jackson ImmunoResearch #715-055-150; 1-to-5,000 dilution), and finally washed twice in TBS-T. To detect bound antibodies, arrays were washed twice in citrate-buffered saline (CBS: 137 mM NaCl, 2.7 mM KCl, 50 mM citric acid monohydrate, pH 7.0). The arrays were transferred to flat glass trays before adding 20 mL Color Developing Solution, made fresh by adding 80 uL BCIP solution [made by dissolving 60 mg BCIP (5-bromo-4-chloro-3-indolylphosphate p-toluidine salt; Sigma #51K1567) per mL absolute dimethylformamide (DMF; Cell Signaling Technologies #12767)] to 120 uL MTT solution [made by dissolving 50 mg of 3-(4,5-Dimethylthiazol-2-yl)-2,5-Diphenyltetrazolium Bromide (MTT) per mL 70% v/v DMF in water] and 100 uL MgCl2 (1 M stock) to 20 mL CBS. Note this specific form of BCIP is crucial to remove the purple color for re-use. The array was then incubated 30–35 min in Color Developing Solution, watching for color development, washed twice in PBS to stop the reaction, and imaged using an Azure Biosystems C600 imager, with the RGB capture setting (Cy2, Cy3, Cy5) and autoexposure. Arrays were stored at 4°C in PBS until the next stage, when they were stripped to remove lamins, antibodies and purple color in a multi-step process: 1) washed twice in 20 mL ddH2O, 2) incubated in 20 mL DMF until the purple color disappeared (typically ∼10 min), 3) washed three times in ddH2O, 4) transferred into a plastic “pouch” (Kapak by Ampac, 404-24) and washed three times (10 min each) in ∼30 mL Stripping Mix A (PBS, pH 7.0, containing 8 M Urea, 1% SDS and 0.5% beta-mercaptoethanol) in a 40°C sonication bath, 5) washed three times in Stripping Mix B (10% acetic acid, 50% ethanol, in ddH2O), and 6) washed three times in 100% ethanol. The stripped array was then imaged and stored at 4°C in PBS until the next cycle of probing and stripping.

Results

The hearts, hind limb skeletal muscle and brains from a total of 19 age-matched (21–22 months old) female c57Bl/6 controls (8 mice) and IL10-KO (11 mice) were harvested, weighed and flash-frozen in liquid nitrogen until use. We prepared whole-tissue protein lysates, sonicating to improve solubilization of lamin networks, and used mouse mAb 4C11, raised against Ig-fold residues 400–550 (shared by lamin A and lamin C) to coimmunoprecipitate native lamins A/C and associated proteins. To determine which ten mice to select for quantitative multiplex mass spectrometry analysis, we used SDS-PAGE to resolve small aliquots of heart immunoprecipitates from all IL10-KO mice (samples 1–11) and all WT control mice (samples 12–19; Supplementary Figure S1). We immunoblotted first with antibody CTD110.6, specific for O-GlcNAc modifications on Ser/Thr, to query potential hyper-O-GlcNAcylation of lamin A (Supplementary Figure S1, α-O-GlcNAc), then stripped and re-probed with antibody SC20681 to detect lamin A and lamin C (Supplementary Figure S1, α-lamin A/C). Both lamins were detected in heart lysates, as expected (Afilalo et al., 2007; Cattin et al., 2015), with similar total (A plus C) signals in IL10-KO and WT hearts. Although the O-GlcNAc-to-lamin A signals trended higher in IL10-KO hearts (Supplementary Figure S1), this was inconclusive because we could not rule out O-GlcNAcylation of proteins that might have co-migrated with lamin A in SDS-PAGE.

We then selected the five mice of each genotype (IL10-KO, control) whose heart, muscle and brain samples moved forward to mass spectrometry analysis, mainly ruling out mice with tumors (mice #2, 5, 11) or skewed/atypical O-GlcNAc signals (mice #1, 7, 15, 18; Supplementary Figure S1). Heart and skeletal muscle proteomes are reported here. Brain yielded the largest proteome (>2,400 candidates) and will be reported separately. In addition, intrigued by the exceptionally high O-GlcNAc signal in the heart from IL10-KO mouse #005 (Supplementary Figure S1), we identified its lamin A/C heart proteome separately, as a case study, without quantification. Mouse #005 had an adrenal tumor, and its heart proteome included many proteins not found in the other ten hearts (data not shown). One such protein, Phf2 (PHD finger protein 2), is a demethylase that derepresses inflammatory genes (Baba et al., 2011; Stender et al., 2012; Park et al., 2016), and can be recruited to promotors by NFκB (p65) to repress transcription (Shi et al., 2014). Because Phf2 was detectably lamin-associated only in a heart that was both chronically inflamed and chronically stressed, presumably due to tumor-derived adrenaline “fight or flight” signaling, we speculate that adrenal signaling alone or in combination with inflammation might promote Phf2 association with A-type lamins, and thereby contribute to de-repression of inflammatory genes. We wonder if Phf2 might be relevant to a patient with adrenal Cushing syndrome who experienced multiple LMNA (p.R545H)-associated laminopathies (Guillín-Amarelle et al., 2018), or during idiopathic inflammatory myopathy (Komaki et al., 2011; Moraitis et al., 2015) or other stress conditions.

Identification and quantification of native lamin A/C proteomes in heart and skeletal muscle

Proteins immunoprecipitated from each sample were uniquely covalently marked using Tandem Mass Tags (TMT; Thompson et al., 2003), a stable isotope-based approach that allows all ten samples from the same tissue (e.g., hearts) to be pooled for multiplex analysis and quantification by mass spectrometry. Potential changes in lamin A/C association were measured after normalizing each protein to the lamin A/C signals in the same sample. Significant log2-fold changes in protein abundance were quantified based on normalized WT-to-IL10-KO signal ratios using the empirical Bayes method described by Rucinski and others (Kammers et al., 2015). Raw results for all identified proteins in skeletal muscle and heart are provided in Supplementary Table S1, and normalized results in Supplementary Table S2.

To focus further analysis, proteome datasets were filtered by removing ribosomal proteins, keratins and most mitochondrial proteins as presumed contaminants (Supplementary Table S3). Sarcomeric proteins, which are highly abundant and relatively insoluble in heart and muscle, were also presumed contaminants of immunoprecipitation but were not filtered out. Our final filtered Supplementary Table S4 was curated manually to note proteins that were: 1) known or predicted (Cytoscape version 3.8.2) to localize in the nucleus, 2) reported to bind lamin A/C directly, or 3) identified as nuclear envelope integral membrane proteins (“NETs”). NET classification was based on biochemical isolation of native NETs from liver, white blood cells or C2C12 myoblasts [Supplementary Table S4 in Korfali et al. (2010), Korfali et al. (2012), Worman and Schirmer (2015)], or from cultured mesenchymal stem cells, adipocytes or myocytes [Supplementary Tables S1, S2 in Cheng et al. (2019)].

Overview of native lamin A/C proteomes: 62 proteins identified in both heart and skeletal muscle

We identified ∼340 proteins in heart and ∼500 proteins in skeletal muscle with high confidence (Supplementary Table S4). Sixty-two proteins were identified in both heart and muscle (examples shown in Figure 1), including chromatin regulators Smyd1 [adds the repressive H3K4me “mark” on histone H3 (Tracy et al., 2018)] and SetD2 [adds the H3K36me3 mark; (McDaniel and Strahl, 2017)], dystrobrevin-alpha [Dtna; (Aguilar et al., 2015)]; and Tmem38a (aka “Trimeric intracellular cation channel type A”), a nuclear membrane protein required for muscle-specific 3D genome organization (Robson et al., 2016) and genetically linked to Emery-Dreifuss muscular dystrophy (Meinke et al., 2020). Additional proteins identified in both tissues included NAMPT [controls the rate-limiting step in NAD biosynthesis, and the release of Clock-Arntl/BMAL1 heterodimers from Sirt1-mediated repression; (Ramsey et al., 2009); (Maynard et al., 2022)], Gapdh [glyceraldehyde-3-phosphate dehydrogenase; enters the nucleus during glucose starvation (Chang et al., 2015) and autophagy (Iqbal et al., 2021)], transcription factor Fhl1 (Roux et al., 2012) which interacts with emerin and lamin A and is genetically linked to EDMD (Ziat et al., 2016), and shuttling transcription factor Csrp3 [“muscle LIM protein”; a MyoD1 co-factor that enters the nucleus in response to mechanical force, and protects against muscular dystrophy (Mathiesen et al., 2019)].

FIGURE 1

A small number of nuclear envelope integral membrane proteins (“NETs”) and characterized lamin A/C-binding proteins were identified in the heart, including MLIP (Ahmady et al., 2011), Plcb4 (Dittmer et al., 2014), transcription regulator Kank2 (Dittmer et al., 2014), Sun2 [NET; (Haque et al., 2010)] and RyR2 [ryanodine receptor 2; (Kapiloff et al., 2001; Dridi et al., 2021)]. In skeletal muscle we identified Ryr1 [Ryanodine receptor 1; (Dridi et al., 2021), Matrin 3 (Depreux et al., 2015) and lamin A-proximal proteins Numa1, Pcbp1 (poly(rC)-binding protein, aka HnrnpE1)] and RanGap1 (Roux et al., 2012; Supplementary Table S4). Other expected partners such as emerin were not recovered from striated muscle, but were identified in brain, a soft tissue.

Most identified proteins were not significantly affected in the IL10-KO model of frailty

Most proteins identified in this study were not detectably affected in IL10-KO tissues, as seen in volcano plots for skeletal muscle (Figure 2A) and heart (Figure 2B). This was encouraging because it suggested these proteins reproducibly co-precipitated with native A-type lamins, whether due to genuine association (direct or indirect) or artifact. Curated examples of IL10-KO-unaffected proteins are shown for skeletal muscle in Table 1, and for heart in Table 2. Proteins unaffected by chronic inflammation (IL10-KO) were still of great interest as candidate (novel) partners for A-type lamins in these native tissues. Skeletal muscle candidates included Rragd [regulates mTORC1; (Tsun et al., 2013)], condensin subunits NCAPH (condensin complex subunit 2) and Smc3 (structural maintenance of chromosomes protein 3), chromatin repressor Sirt2 (NAD-dependent protein deacetylase sirtuin-2), scaffolding proteins 14-3-3 epsilon (Ywhae) and 14-3-3 gamma (Ywhag), and transcription factors Bin1 (Myc box-dependent-interacting protein 1), smoothelin, Thrap3 (thyroid hormone receptor-associated protein 3), Dmrt (doublesex- and mab-3-related transcription factor 2), Stat5B and Fhl3 (Table 1), and signaling kinase Akt2 (which can phosphorylate lamin A; Fan et al., 2023). Others included MAP “kinase kinases” (Map2k3, Map2k4, and Map2k6), multiple subunits of the 5′-AMP-activated protein kinase complex (Prkaa2, Prkab2, Prkag1, Prkaca, and Prkar2a), Ca++/calmodulin-dependent protein kinase type II (Camk2a and Camk2g), the protein phosphatase 1 complex (Ppp1cc, Ppp1r12b, Ppp1r3a), as well as protein phosphatase 1B (Ppm1b), protein phosphatase 2 (Ppp2cb), and “TRiC” chaperonin complexes [T-complex protein 1, Cct2/beta, Cct3/gamma, Cct4/delta, Cct7/eta, Cct8/theta; (Jin et al., 2019); Supplementary Table S4]. TRiC complexes are huge (∼1,000 kD) and might have co-precipitated as an artifact of density, but also reportedly associate with heterochromatin (Souès et al., 2003) and function in the nucleus (Pejanovic et al., 2012). Other novel candidates from heart included transcription factor Ndrg2, which protects against ischemia-reperfusion injury (Sun et al., 2013), several kinases (e.g., Speg, Skp1, Taok1, Sgk223), Pias2 (E3 SUMO-protein ligase), Mad1l1 (mitotic spindle checkpoint protein MAD1) and Ppp2ca (Ser/Thr-protein phosphatase 2A catalytic subunit alpha), which regulates an essential lamin-binding protein named Barrier to Autointegration Factor 1 (BANF1) and influences postmitotic nuclear assembly (Ahn et al., 2019).

FIGURE 2

TABLE 1

GeneProtein name
Ugp2UTP--glucose-1-phosphate uridylyltransferase
Vdac3Voltage-dependent anion-selective channel protein 3
Cavin2Caveolae-associated protein 2
Apobec2C- > U-editing enzyme APOBEC-2
NcaphCondensin complex subunit 2
Faf1FAS-associated factor 1
Dnajb4DnaJ homolog subfamily B member 4
Zbed5SCAN domain containing 3
Dmrt2Doublesex- and mab-3-related transcription factor 2
Irak2Interleukin-1 receptor-associated kinase-like 2 isoform a
Tex55Uncharacterized protein C3orf30 homolog
Stat5bSignal transducer and activator of transcription 5B
Alpk3Alpha-protein kinase 3
Mettl14N6-adenosine-methyltransferase subunit METTL14
Anp32aAcidic leu-rich nuclear phosphop’n 32 family member A
Krt90Uncharacterized protein LOC239673
Fhl3Four and a half LIM domains protein 3
Ube2mNEDD8-conjugating enzyme Ubc12 isoform 1
Sh3d21SH3 domain-containing protein 21
Ube2nUbiquitin-conjugating enzyme E2 N
Park7Protein DJ-1
Thrap3Thyroid hormone receptor-associated protein 3
Sirt2NAD-dependent protein deacetylase sirtuin-2
Ankrd2Ankyrin repeat domain-containing protein 2
Prdm2PR domain zinc finger protein 2
HnrnpUHeterogeneous nuclear ribonucleoprotein U
TardbpTAR DNA-binding protein 43
Pdlim7PDZ and LIM domain protein 7
Klhl41Kelch-like protein 41
Prag1Tyrosine-protein kinase SgK223
Fkbp1aPeptidyl-prolyl cis-trans isomerase FKBP1A
RragdRas-related GTP-binding protein D
HdgfHepatoma-derived growth factor
Mybpc1Myosin-binding protein C, slow-type
MarcksMyristoylated alanine-rich C-kinase substrate
OsbpOxysterol-binding protein 1
Pdlim5PDZ and LIM domain protein 5 isoform ENH2
Bin1Myc box-dependent-interacting protein 1
Ywhag14-3-3 protein gamma
SmtnSmoothelin
Fam114a2Protein FAM114A2
Myo18bUnconventional myosin-XVIIIb
Tacc2Transforming acidic coiled-coil-containing protein 2
Mindy1De-ubiquitinating enzyme

Selected skeletal muscle candidates unaffected by IL10-KO.

TABLE 2

GeneProtein name
Eef2Elongation factor 2
Hsp90ab1Heat shock protein HSP 90-alpha beta 1
HNRNPCHeterogeneous nuclear ribonucleoproteins C (C1/C2)
SpegStriated muscle-specific serine/threonine-protein kinase
Bag3BAG family molecular chaperone regulator 3
Irak2Interleukin-1 receptor-associated kinase-like 2
Chchd3MICOS complex subunit Mic19
HNRNPMHeterogeneous nuclear ribonucleoprotein M
HNRNP2b1Heterogeneous nuclear ribonucleoproteins A2/B1
Fabp4Fatty acid-binding protein, adipocyte
Ryr2Ryanodine receptor 2
Taf15TATA-binding protein-associated factor 2N
Skp1S-phase kinase-associated protein 1
Sorbs2Sorbin and SH3 domain-containing protein 2
Ndrg2Protein NDRG2 (N-myc downstream-regulated gene 2)
IGTPInterferon gamma induced GTPase
Ndufa13NADH dehydrogenase
Phf5aPHD finger-like domain-containing protein 5A
ETV3LETS translocation variant 3-like protein
Perm1PGC-1 and ERR-induced regulator in muscle protein 1
Ybx1Nuclease-sensitive element-binding protein 1
Pdlim5PDZ and LIM domain protein 5
Fam210aProtein FAM210A
Ppp2caSerine/threonine-protein phosphatase 2A catalytic subunit
Fhl2Four and a half LIM domains protein 2
Prdm2PR domain zinc finger protein 2
Bcl9B cell CLL/lymphoma 9 protein
Sorbs1Sorbin and SH3 domain-containing protein 1
Lrrfip2Leucine-rich repeat flightless-interacting protein 2
Tmem38aTrimeric intracellular cation channel type A
Smyd1Histone-lysine N-methyltransferase Smyd1
MsnMoesin
GapdhGlyceraldehyde-3-phosphate dehydrogenase
Ndrg2protein NDRG2
Csrp3Cysteine and glycine-rich protein 3 (aka MLP)
Ehd2EH domain-containing protein 2
Pias2E3 SUMO-protein ligase PIAS2
Lmo7LIM domain only protein 7
Sh3d21SH3 domain-containing protein 21
Setd2Histone-lysine N-methyltransferase SETD2
Kiaa2018/USF3Basic helix-loop-helix domain-containing protein USF3
Taok1Ser/Thr-protein kinase TAO1
Slc25a5ADP/ATP translocase 2
Cand2Cullin-associated NEDD8-dissociated protein 2
Sgk223Tyrosine-protein kinase SgK223
Mad1l1Mitotic spindle assembly checkpoint protein MAD1

Selected heart candidates unaffected by IL10-KO.

Two unaffected heart candidates, Perm1 and Fam210A, are relevant to frailty phenotypes

Two proteins, Perm1 (PGC-1 and ERR-induced regulator in muscle protein 1) and Fam210A, were unaffected in IL10-KO hearts but intrinsically interesting as frailty-relevant candidates. Perm1 is an intrinsically disordered protein, highly expressed in heart and skeletal muscle, that regulates genes required for endurance exercise, mitochondrial biogenesis and oxidative capacity in muscle (Cho et al., 2016; Cho et al., 2019; Cho et al., 2021). Perm1 localizes primarily at sites of mitochondrial-ER contact but also enters the nucleus and promotes transcription of genes required for fatty acid oxidation (Huang et al., 2022). Perm1(aka C1orf170) showed selective binding to “progerin,” the toxic internally deleted form of prelamin A, in a yeast two-hybrid study (Dittmer et al., 2014). The other frailty-relevant candidate, Fam210A is genetically linked to human sarcopenia, bone fractures and reduced grip strength (Tanaka et al., 2018; Trajanoska et al., 2018; Tanaka et al., 2020). Fam210A regulates mitochondrial-encoded gene expression and localizes both in mitochondria and the cytoplasm but is relatively uncharacterized as a protein (Wu et al., 2021).

A subset of candidates had significant changes in lamin A/C association in IL10-KO tissue

Certain candidates identified in both tissues were affected by IL10-KO in one tissue. For example, metabolic regulators Fabp4 and Tpi1, with opposite effects on the “browning” of white fat [Fabp4 inhibits; Tpi1 promotes; (Liu et al., 2022)], were both significantly increased in IL10-KO muscle (p < 0.0255 for Fabp4; p < 0.0374 for Tpi1; Table 1). Tpi1 controls nuclear acetate levels and influences global histone acetylation (Zhang et al., 2021). Cryab (aka Hspb5), which enters the cardiomyocyte nucleus in response to non-damaging endurance exercise (Antonioni et al., 2020), was identified in both tissues and showed higher association in IL10tm hearts (p < 0.0146; Table 2). AldoA (Aldolase 1A retrogene 1), which has central roles in glycolysis and gluconeogenesis in the cytoplasm and regulates ribosome biogenesis in the nucleus (Schwarz et al., 2022), showed reduced association in IL10-KO hearts (p < 0.0031; Supplementary Table S4).

∼21 candidates identified only in skeletal muscle were affected by IL10-KO

The subset of proteins from skeletal muscle that changed significantly (p < 0.05) in the frailty model are all listed in Figure 1 and detailed in Supplementary Table S4. Lamin A/C association was significantly reduced for Lmcd1 (p < 0.033), a transcription factor that increases skeletal muscle mass (Ferreira et al., 2019), and three other proteins of interest: Ppme1 [p < 0.034; methylates and inhibits protein phosphatase 2A (Xing et al., 2008; Kauko et al., 2020) and colocalizes with lamin A/C (Pokharel et al., 2015)]; Fxr1 (Fragile X syndrome-related protein 1; p < 0.049, Table 1), and Fbp2 (fructose-1,6-bisphosphatase isozyme 2; p < 0.021), a mitochondrial protein that also binds c-Myc and represses c-Myc-dependent transcription of TFAM, a master (positive) regulator of mitochondrial gene expression, in the nucleus (Huangyang et al., 2020).

∼30 candidates identified only in heart were affected by IL10-KO

The subset of proteins from heart that changed significantly (p < 0.05) in the frailty model are all listed in Figure 1 and detailed in Supplementary Table S4. Lamin A/C association in heart was reduced for ER membrane protein HHATL (protein-cysteine N-palmitoyltransferase HHAT-like protein; p < 0.00034) and two mitochondrial proteins: Acsl1 (long-chain-fatty-acid CoA ligase 1; p < 0.00005) and Cpt1B (carnitine O-palmitoyltransferase 1; p < 0.0016; Table 2; see Discussion). Lamin A/C association increased for Myl6 (myosin light chain 6; p < 0.00076), Pygb (glycogen phosphorylase, brain isoform; p < 0.0088; Uno et al., 1998; enters nucleus: Sun et al., 2019), Cryab (p < 0.015), Aldoa (p < .0.003) and Gins3 (3.5-fold increase; p < 0.041; Table 2). Gins3 is a subunit of DNA helicase complexes (Kamada, 2012) that also regulates myocardial repolarization (Milan et al., 2009; Newton-Cheh et al., 2009) and is downregulated in metabolically unhealthy obese adults (Das et al., 2015).

Rationale and overview of peptide array screening strategy

There were many reasons why protein association with lamin A/C might have changed in IL10-KO tissues, from altered mRNA expression to changes in the posttranslational modifications, nuclear localization or stability of any given candidate protein. We therefore chose a proof-of-principal validation question: did these native proteomes include any novel lamin A-binding proteins? We knew it was feasible to use recombinant lamin A “tails” (residues 385–646) as probes to detect binding to SDS-PAGE-resolved partners such as emerin (Lee et al., 2001), and we previously used peptide arrays to map sites of emerin-emerin interaction (Berk et al., 2014) that were validated in mechanically stressed cells (Fernandez et al., 2022). We therefore chose a peptide array strategy to test candidate binding to recombinant lamin A.

We screened 11 candidates, favoring smaller proteins to fit more per array. Seven candidates are reported here; four will be reported with the brain proteome. Each candidate was displayed as a series of 20-mer synthetic peptides (staggered by seven residues) on cellulose (“peptide array”). The entire array was then probed with purified recombinant mature lamin A “tail” residues 385–646, which includes the flexible linker (residues 385–429) and Ig-fold domain (residues 430–544) shared with lamin C, plus disordered C-terminal residues 545–646 unique to mature lamin A. We used two identical arrays. One array was incubated first with recombinant lamin A, and then with primary (anti-lamin A/C) and secondary antibodies to detect the bound lamins, as shown in panels A of Figures 39 (first probe: LamA + Abs). To control for array ‘stickiness’ during their first use, our negative control for the first experiment was to incubate an identical array first (and solely) with antibodies, as shown in panels A of Figures 39 (first probe: control Abs-only). For the second full experiment, both arrays were urea-stripped, probed with lamin A protein and antibodies (Figures 39, second probe: LamA + Abs), then urea-stripped again and probed with antibodies alone (Figures 39, second probe: control Abs-only). The arrays also included peptides representing the lamin A tail itself (residues 385–664), and peptides unique to either lamin C (DEDEDGDDLLHHHHVSGSRR) or “progerin” (CGQPADKASASGSGAQSPQN and ADKASASGSGAQSPQNCSIM), or nuclear membrane protein emerin as positive control. Because many peptides gave high (Ab-only) backgrounds, spot signals were scored independently by two individuals as either weak (+), moderate (++) or strong (+++), compared to the corresponding Ab-only control (panels B of Figures 39). Potential sites of Lamin A-binding in each candidate were judged based on signal intensity and consistency (positive in both experiments, or consecutive overlapping peptides), and annotated in the full amino acid sequence (panels C of Figures 39). For candidates with known atomic structures, we used PyMol and blue shading to determine if putative lamin-binding peptides were plausibly solvent-exposed. For structurally uncharacterized candidates (Lmcd1, Tmem38a), we relied on Alphafold predictions.

FIGURE 3

FIGURE 4

FIGURE 5

FIGURE 6

FIGURE 7

FIGURE 8

FIGURE 9

Peptide array results suggest lamin A tails can interact with neighboring Ig-folds

We included lamin A peptides in the arrays both to query tail-tail interactions, and as a positive control to identify the epitope recognized by the detection system’s lamin A/C antibody. Our detection system (primary anti-lamin A/C and secondary antibodies) was strongly positive for lamin A peptides w16, w17 and x17 (black boxes, Figure 3A, first probe, control Abs-only). The overlapping peptides w16 (aa 464–483; MGNWQIKRQNGDDPLLTYRF) and w17 (aa 471–490; RQNGDDPLLTYRFPPKFTLK) are located in the Ig-fold shared by lamin A and lamin C; from this we deduced the epitope resided in residues 464–490 (gray; Figures 3C,D). Positive x17 (aa 611–630; ISSGSSASSVTVTRSYRSVG) was unique to lamin A, hence ruled out as the primary epitope. We speculate the epitope includes “480TYR,” since peptide x17 included homologous residues ‘625SYR’. However, this and other background positives remain unexplained.

We detected consistently strongest specific binding of lamin A tails to prelamin A peptide W14 (aa 450–469; KFVRLRNKSNEDQSMGNWQI) and slightly lower signals for overlapping peptides W19 (aa 485–504; PKFTLKAGQVVTIWAAGAGA) and X1 (aa 499–518; AAGAGATHSPPTDLVWKAQN; spots blue-boxed in Figure 3A; scored in Figure 3B). All three positives were located in the Ig-fold, as shown in the amino acid sequence (gray underbar, Figure 3C) and depicted in Figure 3D. The strongest positive, peptide w14, includes many solvent-exposed residues that snake around the bottom and back of the Ig-fold (dark blue in Figure 3D). The other positives, also largely solvent-exposed, occupy most of the “bottom” and “back” surfaces of the Ig-fold (light blue; Figure 3D). These proposed lamin tail-tail interaction regions do not overlap the binding site for BANF1 [pink; front view in Figure 3D; (Samson et al., 2018)]. Lamin A tails did not bind detectably to the lamin C-specific peptide “y3” (Figure 3A) or progerin-specific peptides (data not shown). In the context of lamin filaments, these results suggested that an unidentified region(s) of the lamin A tail (Ig-fold, A-specific disordered region, or both) can interact with the “bottom” and “back” of neighboring Ig-folds (Figure 3D), consistent with an elegant molecular crosslinking study of native lamin A filaments in living cells (Makarov et al., 2019).

Lamin A binding to emerin

The antibody-only control gave puzzlingly strong recognition of emerin, especially peptides y6 (aa 15–24; LLRRYNIPHGPVVGSTRRLY) and z11-z12 (aa 190–216; FMSSSSSSSSWLTRRAIRPENRAPGAG), and also broadly recognized the N-terminal region (y4–y10), middle (y16–y18; aa 85–118) and C-terminal region (z14–z18; aa 211–254) (Figures 4A, B; first probe, control Abs-only). We first checked, and ruled out, potential switching of the two images. Against this formidable and disappointing background, one peptide was weakly positive in both experiments: emerin z10 (aa 183–202; PTSSSTSFMSSSSSSSSWLT). This peptide resides in one of two large fragments of emerin, namely residues 1–132, and 159–220— each sufficient to bind lamin A (Berk et al., 2014). This result suggested lamin A contacts emerin residues 183–202 near the transmembrane domain, between two peptides (SAYQS region and R-peptide) involved in emerin-emerin association (Berk et al., 2014; Figure 4C).

Robust binding of lamin A tails to Perm1

We detected strong lamin A binding to three Perm1 peptides (Figures 5A, B), namely h5 (aa 441–460; SSGLVSTPVPRADAAGLAWP), i4 (aa 593–612; EENEEAEAAAAGQDPAGVQW) and j2 (aa 737–756; FVAFATWAVRTSDPHTPDAW), and consistent weaker binding to h16 (aa 529–548; QTATGAHGGPGAWEAVAVGP), as annotated in the full amino acid sequence of Perm1 (Figure 5C). We were unable to evaluate these peptides in a structural context, since Perm1 is almost entirely disordered, except to note that the proposed lamin A-binding peptides are all located in the C-terminal half of Perm1, and that two sites have predicted α-helicity (Figure 5D). Our conclusion that Perm1 can bind mature lamin A was unexpected, since a previous yeast two-hybrid study reported detectable binding of Perm1 (known as C1orf179) only to progerin (Dittmer et al., 2014).

Weak lamin A tail binding to the N-terminal region of Csrp3 (muscle LIM protein “MLP”)

Csrp3, also known as “muscle LIM protein” (MLP), is a nucleocytoplasmic shuttling protein that crosslinks and bundles F-actin and influences myocyte remodeling and responses to cardiac hypertrophy (Hoffmann et al., 2014). We observed weak lamin A tail binding to Csrp3 peptide s7 (aa 1–20; MPNWGGGAKCGACEKTVYHA) in both experiments, and weak binding to overlapping peptides s9–s11 (aa 15–48; KTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTT) and t5–t6 (aa 127–146; VYAAEKVMGGGKPWHKTCFRCAICGKS) in the second experiment (Figures 6A, B). We were unconfident about the strong signals for peptides s14–s15 in the second experiment due to their high background signals in the first experiment (Figures 6A, B). The full amino acid sequence of Crsp3 is shown in Figure 6C. Csrp3 has two zinc-binding domains: LIM domain-1 (residues 7–66; Figure 6D) mediates Csrp3 dimerization, whereas LIM domain-2 (residues 119–176; Figure 6D, right) binds F-actin (Hoffmann et al., 2014). Our array data suggests lamin A binds disordered residues 1–6 and solvent-exposed residues 7–20 of LIM domain-1 (shaded blue in Figure 6D) and might therefore influence Csrp3 dimerization.

Strong lamin A binding to Lmcd1 (LIM and cysteine-rich domain 1)

We detected strong consistent lamin A tail binding to Lmcd1 peptide v17 (aa 309–328; SGCDEIIFAEDYQRVEDLAW), and consistent but weaker binding to three peptides (u8–u10) that shared residues 113–132 (FDTITYEWAPPGVTQKLGLQ) (Figures 7A, B). Given the limitations of this assay we drew no conclusions from the faint signals seen with peptide t13 (aa 1–20), and other peptides that were positive only in the second experiment (Figures 7A, B). Convincing positives were annotated in the amino acid sequence of Lmcd1 (Figure 7C). Lmcd1 has a putative protein-protein interaction (“PET”) domain (residues 99–206), a disordered region (residues 200–235) and two predicted LIM zinc-binding domains (residues 241–306, and 307–365; Figure 7C). The strongest lamin A-binding site (peptide v17, in the second zinc-binding domain) is almost entirely solvent-exposed in the Alphafold-predicted structure of Lmcd1 (shaded blue in Figure 7D). The weaker lamin A-binding site (residues 113–132) in the putative protein-protein interaction region includes eight predictedly solvent-exposed residues (shaded blue in Figure 7D).

Strong binding of lamin A to AldoA

Lamin A tails showed consistently strong binding to overlapping AldoA peptides r16 (aa 281–300; SINLNAINKCPLLKPLLKPWALTF), r18 (aa 295–314; PWALTFSYGRALQASALKAW), r19 (aa 302–321; YGRALQASALKAWGGKKENL) and r20 (aa 309–328; SALKAWGGKKENLKAAQEEY; Figures 8A, B). We were intrigued to see that peptide r16 (aa 281–314) was mostly buried in the X-ray crystal structure (Figure 8D). The exceptions were residues P295, W296, A297 (“PWA”), on a concave surface (shaded blue in “front” view, Figure 8D), and residues K312, A313 and W314 (‘KAW’; shaded blue or white in Figures 8C, D). “PWA” was shared by overlapping AldoA peptides r16 and r18 (Figure 8B), and “KAW” by three strongly positive overlapping peptides (r18–r20; Figure 8B). We noticed similar “AW” residues in strongly positive peptides from Lmcd1 (326LAW; Figure 7B) and Perm1 (457LAW, 539GAW, 754DAW; Figure 5B); comparison suggested elements of a potential shared motif (see Discussion).

Robust lamin A tail binding to nuclear membrane protein Tmem38a

Lamin A showed consistently strong binding to Tmem38A peptide j13 (aa 36–55; YLKYEPGAVELSRRHPIASW; Figures 9A, B). Other consistent positives were k10 (aa 155–174; KGSGVALMSNFEQLLRGVWK) and k16 (aa 197–216; FTLQQTRWLPVSKASLIFIF). We disregarded weaker positives k12 (aa 169–188; LRGVWKPETNEILHMSFPTK) and L7–L8 (aa 274–299; QHSAMPAKSKEELSEGSRKKKAKKAD). We disregarded strong peptides k6–k7 because they were inexplicably positive in the antibody-only control (Figure 9A, first probe). Tmem38 is an integral membrane protein that localizes at the nuclear envelope inner membrane in muscle cells (Robson et al., 2016). Tmem38A is homologous to trimeric intracellular cation type-A (TRIC-A) channels, crystal structures for which were determined only in procaryotic and C. elegans orthologs (Kasuya et al., 2016). The structure of human Tmem38A has not been determined and was variously predicted to have three (Zhou et al., 2014) or four (Meinke et al., 2020) transmembrane helices. Our Alphafold prediction suggests five membrane-spanning helices (gray bars in Figure 9C; helices 1–3 colored green and helices 4–5 red in Figure 9E), three membrane-adjacent helices (residues 1–18, 236–249, and 285–295), and at least one “kinked” (partially bilayer-inserted) helix. Putative helix-2 and helix-5 are quite long and probably protrude beyond the lipid bilayer. Since Alphafold does not depict the lipid bilayer, we approximated crudely as depicted by gray lines in Figure 9D. This Alphafold-predicted topology suggests the C-terminus, lamin A-binding peptide j13 (residues 36–55) and most of lamin-binding peptide k10 (residues 158–174) are exposed and accessible in vivo (AF-Q9HF2-F1; residues 36–55 dark blue, residues 158–174 light blue, in Figures 9D–F). The third identified site (peptide k16) is predicted to localize in the lumen (Figure 9D), inaccessible to lamins in vivo.

Discussion

This study identified lamin A/C-associated proteomes from two native tissues, heart and skeletal muscle, often perturbed in laminopathy and frailty. We begin with the limitations of this study. First, we recovered fewer-than-expected known partners and few integral membrane proteins from heart and skeletal muscle. We attribute this deficit to the challenges inherent in solubilizing lamin-associated proteins from relatively insoluble nuclear lamina networks in cells filled with insoluble contractile networks, because our same solubilization protocol yielded numerous known partners and integral membrane proteins when applied to softer tissue (brain; manuscript in preparation). Thus, different (e.g., proximity labeling) strategies could still be fruitfully applied in striated tissues. Second, with respect to the ∼51 proteins that showed differential lamin A/C association in frail (IL10-KO) tissue, we did not determine why association changed. Changes could be due to many factors downstream of chronic inflammation, including gross changes in the abundance, posttranslational modification or nuclear localization of any given protein. A subset of proteins identified with high-confidence by mass spectrometry had large magnitude (e.g., >200-fold), yet statistically insignificant, changes in lamin A/C association in IL10-KO tissue, as shown in Supplementary Table S5. This we attributed to the small sample size of this study, or more speculatively to posttranslational modifications that ‘removed’ specific peptides from the analysis. Nor did we stain candidates by indirect immunofluorescence to visually confirm lamin A/C association or changes thereof in IL10-KO versus control tissues. Finally, to minimize false positives, we probed the peptide arrays stringently, with lamins at 190 nM concentration, within the range of most but not all affinities measured for emerin [e.g., 40 nM for lamin A; 4–500 nM for other partners; see Berk et al. (2013)]. In cells, lamin concentrations near the inner nuclear membrane are estimated at >10 uM (Holaska et al., 2003).

Despite these limitations, our major conclusion is that these native lamin A/C proteomes from heart and skeletal muscle are usefully enriched in novel partners relevant to laminopathy and frailty. Among the seven candidates screened here for lamin A-binding, two (Fabp4, Gins3) gave negative results, one was detectably positive (Csrp3) and four (Lmcd1, AldoA, Perm1, Tmem38A) showed strong binding that allowed us to map and evaluate putative lamin A-binding sites at the molecular level. WebLogo analysis of strong-binding peptides showed patterns of frequent residues around an invariant Trp (Supplementary Figure S2), which is barely visible in Lmcd1 and AldoA (white in Figure 7C, Figure 8C). Further analysis of these and additional lamin-binding peptides will be needed to determine if it is possible to define a lamin-binding motif, or locate its hypothetical docking site on lamin A.

Independent evidence for molecular interplay between lamin A/C tails

Our evidence suggests lamin A “tails” (including the Ig-fold), which extend flexibly away from the filament backbone, have the capacity to interact with nearby tails either on the same filament, or possibly different filaments. These results independently support previous crosslinking evidence that lamin tails can associate with each other in the context of native filament networks (Makarov et al., 2019). Furthermore our lamin-binding peptides were located on the “bottom” and “back” of the Ig-fold, away from the binding site for BANF1 (Samson et al., 2018), suggesting these proposed tail-tail interactions would not interfere with BANF1, an essential partner. More work is needed to determine which region of lamin A (Ig-fold, or disordered A-specific tail) contacts neighboring Ig-folds, and whether such interactions affect filament dynamics in vivo (Makarov et al., 2019).

CSRP3, LMCD1, ALDOA, PERM1: candidate genes for Emery-Dreifuss muscular dystrophy that may also provide insight into frailty-related muscle weakness?

The genes encoding four novel lamin A-binding proteins identified in this study are worth testing for potential genetic linkage to “unmapped” EDMD patients. These proteins may also be relevant to understanding the pervasive muscle weakness phenotypes of frail patients.

Csrp3

Csrp3 was lamin A/C-associated in both heart and muscle and directly binds lamin A, yet was unaffected by IL10-KO. CSRP3 is a plausible EDMD candidate gene because Csrp3 is a mechanosensitive transcription regulator in muscle and cofactor for MyoD1 (Mathiesen et al., 2019), and also binds LC3 and promotes autophagy as a mechanism of protection against muscular dystrophy (Cui et al., 2020). Autophagy is an important protective mechanism (Choi and Worman, 2013). Mitochondrial autophagy is deficient in IL10-KO skeletal muscle (Ko et al., 2016). Two other LIM domain proteins involved in autophagy were also identified in our study: Fhl1 in heart and muscle (Sabatelli et al., 2014) and Fhl2 in heart (Xia et al., 2017). Peptide mapping showed lamin A binds one of two LIM domains in Csrp3, and one of two LIM domains in Lmcd1. The significance of lamin A binding to LIM domains, per se, is unknown, since LIM domains are widespread and diverse mediators of protein-protein interactions (Kadrmas and Beckerle, 2004). We also identified Lmo7 (LIM domain only 7) in the heart proteome; Lmo7, a signaling transcription factor genetically linked to Emery-Dreifuss muscular dystrophy, binds emerin (Holaska et al., 2006) but to our knowledge is untested for binding to lamin A.

Lmcd1

Lmcd1 association with lamin A/C was reduced significantly in frail (IL10-KO) muscle. Lmcd1 is a positive regulator of muscle mass and muscle fiber size, and battles fatigue by repressing myoregulin (Ferreira et al., 2019). Lmcd1 is a Z-disc protein that responds to mechanical load (Luosujärvi et al., 2010), mediates cardiac hypertrophy (Frank et al., 2010), and is a shuttling transcription repressor that blocks the DNA-binding activity of transcription activator GATA6, which regulates lung and cardiac tissue-specific promoters (Rath et al., 2005). Lamin A and GATA6 both interact with the second LIM-domain of Lmcd1, suggesting lamin A might compete with GATA6 and potentially free GATA6 to promote transcription. Lmcd1 is functionally relevant to EDMD. Its reduced association with lamin A/C in IL10-KO muscle suggests Lmcd1 is also relevant to sarcopenia and fatigue in frailty and warrants further testing.

AldoA

Novel lamin A-binding protein glycolytic enzyme AldoA, identified in both heart and muscle, was significantly reduced in IL10-KO hearts. AldoA links glycolysis to ribosome biogenesis (Schwarz et al., 2022), and has protective roles in the heart related to Notch signaling (Luo et al., 2021). Our results are consistent with AldoA functioning in the nucleus and further suggest AldoA is relevant to the mechanisms of laminopathy and frailty. Further studies of AldoA are clearly warranted.

Perm1

Transcription co-activator Perm1, an essential regulator of mitochondrial and cardiac energetics (Oka et al., 2022) and fatty acid metabolism (Huang et al., 2022), was lamin A/C-associated in hearts and recognized by mature lamin A in the peptide array. Perm1 is attractive to consider in the context of frailty because it also regulates genes required for endurance exercise and promotes mitochondrial biogenesis and oxidative capacity in muscle (Cho et al., 2016; Cho et al., 2019; Cho et al., 2021). As a disordered protein, Perm1 lacks conventional structure and is likely controlled by differential posttranslational modifications. Other partners for Perm1 in the heart include transcription co-activators BAG6, Kank2, ERRα and PGC-1α (Oka et al., 2022); among these we identified Kank2 as lamin A/C-associated (and unaffected by IL10-KO) in the heart.

Calpain-1 catalytic subunit, a mitochondrial protein not known to enter the nucleus, was significantly reduced in IL10-KO skeletal muscle (p < 0.0032), as were many other mitochondrial proteins. Reduced mitochondrial proteins (even as contaminants) was expected, since mitochondrial loss is a phenotype of the IL10-KO model (Ko et al., 2016). Interestingly, we also identified legitimate regulators of mitochondrial biogenesis associated with lamin A/C. Perm1, a key positive regulator of mitochondrial biogenesis, was unaffected in IL10-KO muscle. Fbp2, a key negative regulator that represses nuclear-encoded mitochondrial genes (Huangyang et al., 2020), showed significantly reduced lamin A/C association in IL10-KO muscle (p < 0.021). Further studies are needed to test the biological relevance and subnuclear localizations of Perm1 and Fbp2, because one cannot predict if a given partner is active or sequestered (inactive) when bound to lamins. Furthermore, lamins are not solely associated with silent chromatin; subpopulations of lamin A and lamin C localize in the nuclear interior and support transcriptional activity (Naetar et al., 2017). We speculate that if Fbp2 were normally sequestered by association with lamins, then reduced association in IL10-KO muscle would imply that Fbp2 gains freedom to repress mitochondrial genes.

Lamin A-binding sites in Tmem38 did not include residue N261, mutation of which causes EDMD

Tmem38A has two unreconciled roles: on one hand, an intracellular cation channel at the nuclear inner membrane; on the other, a muscle-specific regulator of 3D chromosome organization (Czapiewski et al., 2016; Robson et al., 2016). Given the current uncertainty about the structure and topology of Tmem38a, our best prediction is that two of our three identified lamin-binding sites in Tmem38a are exposed and accessible to lamins in vivo (Figures 9D, E). Interestingly, none of our lamin A-binding peptides included residue N261 (boxed in Figure 9C), the site of a recently-reported EDMD-causing mutation, p.N260D [numbered without the initiating Met; (Meinke et al., 2020)]. Since residue N261 is predicted to be exposed (Figure 9D), we speculate that this mutation disrupts Tmem38A in some other way, for example by perturbing Tmem38A binding to a different EDMD-relevant partner such as emerin, Fhl1, Lemd3/Man1, Sun1, Sun2, Tmem201, Tmem43/Luma, Nesprin-1, Nesprin-2 or Nesprin-3 (Meinke et al., 2020). Further work on the structure and function of Tmem38a is needed to understand this fascinating and disease-relevant protein.

Fabp4 and Gins3: significantly higher lamin A/C association in IL10-KO muscle and heart, respectively, but no detectable binding to lamin A

Lamin A gave no detectable binding to Fabp4 or Gins3 peptides (data not shown). Since negative results are inconclusive, further studies with full-length proteins will be needed to retest potential binding to lamin A, and also test lamin C. One enduring mystery is how lamins A and C, with residues 1–566 identical, nevertheless form separate filaments (Shimi et al., 2015) and have distinct roles in metabolism and lifespan (Fong et al., 2006; Lopez-Mejia et al., 2014) and tissue-specific 3D chromosome organization (Wong et al., 2021b). As lamin A/C-associated and IL10-KO-affected candidates important for metabolism (Garin-Shkolnik et al., 2014; Das et al., 2015; Hotamisligil and Bernlohr, 2015; Liu et al., 2022), Fabp4 and Gins3 both warrant further investigation.

Statements

Data availability statement

The raw mass spectrometry data for this study are publicly available via figshare for heart (10.6084/m9.figshare.24187089) and skeletal muscle (10.6084/m9.figshare.24187086).

Ethics statement

The animal study was approved by the Johns Hopkins University Institutional Animal Care and Use Committee. The study was conducted in accordance with the local legislation and institutional requirements.

Author contributions

KW designed, supervised and analyzed this study. JW contributed intellectually and supervised mouse work and tissue collection. TD contributed intellectually, prepared and analyzed tissue lysates, and immunoprecipitated samples for mass spectrometry, and did the Clustal Omega and WebLogo analysis. RC and LD contributed intellectually and did the TMT-labeling, mass spectrometry analysis and searches. AA and AR-J contributed intellectually and filtered and curated the proteomic results, using software designed by AA. FE, AS, and NP contributed intellectually and did the peptide array experiments. AS, FE, and KW analyzed the peptide array results. AS, FE, AA, and TD prepared figures. KW wrote the manuscript, with written contributions by FE, AS, AA, and TD. All authors contributed to the article and approved the submitted version.

Funding

This work was supported by pilot grants to KW from the Johns Hopkins University Claude D. Pepper Older Americans Independence Center funded by the National Institute on Aging at NIH (P30AG021334).

Acknowledgments

We thank members of the Walston lab, especially Jackie Langdon, for mouse tissue harvest, Alyssa Florwick for preliminary studies, Nicole S. Aloeyi for early analysis of Csrp3, Eno O.B. Udoh for thoughtful early help with figures, Alexander B. Austin in the Biopolymers and Proteomics Core Facility at the Koch Institute Swanson Biotechnology Center at Massachusetts Institute of Technology (Cambridge MA) for peptide arrays, and Anastasia Kralli (Johns Hopkins University) for helpful discussions.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fcell.2023.1240285/full#supplementary-material

SUPPLEMENTARY FIGURE S1

Mice used in this study. (Top) Western blots of lamin A/C immunoprecipitates from the hearts of all 19 starting mice, collected on the same day. To normalize against blot-to-blot variation (especially when detecting O-GlcNAc) each gel included samples from both IL10-KO and control hearts. The number above each lane (e.g., “1, 2”) corresponds to the mouse listed in the Table (e.g., “M001”, “M002”). SDS-resolved samples were transferred and probed first for the O-GlcNAc modification (left; α-O-GlcNAc), then stripped and re-probed for lamin A/C (α-lamin A/C) using an antibody different from the immunoprecipitating antibody. The blots shown are representative of two independent replicates. We tested O-GlcNAc to ask if lamin A was hyper-O-GlcNAcylated in frailty. Because posttranslational modifications on native lamin A can shift its migration in gels, lamin A signals were collected as indicated by the bracket at right. O-GlcNAc-to-lamin A ratios trended higher in IL10-KO hearts, but we considered a potential difference insignificant given the variation between mice and our inability to rule out O-GlcNAcylation of co-migrating proteins. (Bottom) Table that details genotype, age, weights and notes (during tissue collection) about the 19 mice considered for this study, and shows which mouse samples were selected for proteomic analysis. IL10-KO genotype denoted as “IL10tm” in the Table.

SUPPLEMENTARY FIGURE S2

Clustal Omega and WebLogo display of amino acids common to lamin-binding peptides near an invariant Trp residue.

SUPPLEMENTARY TABLE S1

Unfiltered mass spec results for heart and muscle (WT vs IL10-KO, denoted as “IL10tm” or “KO”).

SUPPLEMENTARY TABLE S2

Proteins identified in heart and muscle (WT vs IL10-KO, denoted as “IL10tm” or “KO”) after normalization to lamin A (‘prelamin A’) in each sample.

SUPPLEMENTARY TABLE S3

Proteins identified in heart and muscle (WT vs IL10-KO, denoted as “IL10tm” or “KO”) after both normalization to lamin A, and filtering to remove most mitochondrial proteins and all ribosomal proteins and keratin as presumed contaminants.

SUPPLEMENTARY TABLE S4

Same as Supplementary Table S3, with protein names matched with gene names and manually curated as described in Methods.

References

  • 1

    AfilaloJ.SebagI. A.ChalifourL. E.RivasD.AkterR.SharmaK.et al (2007). Age-related changes in lamin A/C expression in cardiomyocytes. Am. J. Physiol. Heart Circ. Physiol.293 (3), H1451H1456. 10.1152/ajpheart.01194.2006

  • 2

    AguilarA.WagstaffK. M.Suárez-SánchezR.ZinkerS.JansD. A.CisnerosB. (2015). Nuclear localization of the dystrophin-associated protein α-dystrobrevin through importin α2/β1 is critical for interaction with the nuclear lamina/maintenance of nuclear integrity. FASEB J.29 (5), 18421858. 10.1096/fj.14-257147

  • 3

    AhmadyE.DeekeS. A.RabaaS.KouriL.KenneyL.StewartA. F.et al (2011). Identification of a novel muscle A-type lamin-interacting protein (MLIP). J. Biol. Chem.286 (22), 1970219713. 10.1074/jbc.M110.165548

  • 4

    AhnJ. H.ChoM. G.SohnS.LeeJ. H. (2019). Inhibition of PP2A activity by H2O2 during mitosis disrupts nuclear envelope reassembly and alters nuclear shape. Exp. Mol. Med.51 (6), 118. 10.1038/s12276-019-0260-0

  • 5

    Al SaediA.GunawardeneP.BermeoS.VogrinS.BoersmaD.PhuS.et al (2018). Lamin A expression in circulating osteoprogenitors as a potential biomarker for frailty: the Nepean Osteoporosis and Frailty (NOF) Study. Exp. Gerontol.102, 6975. 10.1016/j.exger.2017.11.015

  • 6

    AntonioniA.DimauroI.FantiniC.BaroneR.MacalusoF.Di FeliceV.et al (2020). αB-crystallin response to a pro-oxidant non-cytotoxic environment in murine cardiac cells: an "in vitro" and "in vivo" study. Free Radic. Biol. Med.152, 301312. 10.1016/j.freeradbiomed.2020.03.013

  • 7

    BabaA.OhtakeF.OkunoY.YokotaK.OkadaM.ImaiY.et al (2011). PKA-dependent regulation of the histone lysine demethylase complex PHF2-ARID5B. Nat. Cell Biol.13 (6), 668675. 10.1038/ncb2228

  • 8

    BarD. Z.AtkatshK.TavarezU.ErdosM. R.GruenbaumY.CollinsF. S. (2018). Biotinylation by antibody recognition-a method for proximity labeling. Nat. Methods15 (2), 127133. 10.1038/nmeth.4533

  • 9

    BerkJ. M.SimonD. N.Jenkins-HoukC. R.WesterbeckJ. W.Grønning-WangL. M.CarlsonC. R.et al (2014). The molecular basis of emerin-emerin and emerin-BAF interactions. J. Cell Sci.127, 39563969. 10.1242/jcs.148247

  • 10

    BerkJ. M.TifftK. E.WilsonK. L. (2013). The nuclear envelope LEM-domain protein emerin. Nucleus4 (4), 298314. 10.4161/nucl.25751

  • 11

    BerkJ. M.WilsonK. L. (2016). Simple separation of functionally distinct populations of lamin-binding proteins. Methods Enzymol.569, 101114. 10.1016/bs.mie.2015.09.034

  • 12

    BoschJ. A.ChenC.-L.PerrimonN. (2021). Proximity-dependent labeling methods for proteomic profiling in living cells: an update. Wiley Interdiscip. Rev. Dev. Biol.10 (1), e392. 10.1002/wdev.392

  • 13

    BrullA.RodriguezB. M.BonneG.MuchirA.BertrandA. T. (2018). The pathogenesis and therapies of striated muscle laminopathies. Front. Physiol.9, 1533. 10.3389/fphys.2018.01533

  • 14

    CapturG.ArbustiniE.BonneG.SyrrisP.MillsK.WahbiK.et al (2018). Lamin and the heart. Heart104 (6), 468479. 10.1136/heartjnl-2017-312338

  • 15

    CattinM. E.WangJ.WeldrickJ. J.RoeskeC. L.MakE.ThornS. L.et al (2015). Deletion of MLIP (muscle-enriched A-type lamin-interacting protein) leads to cardiac hyperactivation of Akt/mammalian target of rapamycin (mTOR) and impaired cardiac adaptation. J. Biol. Chem.290, 2669926714. 10.1074/jbc.M115.678433

  • 16

    ChangC.SuH.ZhangD.WangY.ShenQ.LiuB.et al (2015). AMPK-dependent phosphorylation of GAPDH triggers Sirt1 activation and is necessary for autophagy upon glucose starvation. Mol. Cell60 (6), 930940. 10.1016/j.molcel.2015.10.037

  • 17

    ChararC.GruenbaumY. (2017). Lamins and metabolism. Clin. Sci. (Lond)131 (2), 105111. 10.1042/CS20160488

  • 18

    ChengL. C.BabooS.LindsayC.BrusmanL.Martinez-BartoloméS.TapiaO.et al (2019). Identification of new transmembrane proteins concentrated at the nuclear envelope using organellar proteomics of mesenchymal cells. Nucleus10 (1), 126143. 10.1080/19491034.2019.1618175

  • 19

    ChoY.HazenB. C.GandraP. G.WardS. R.SchenkS.RussellA. P.et al (2016). Perm1 enhances mitochondrial biogenesis, oxidative capacity, and fatigue resistance in adult skeletal muscle. FASEB J.30, 674687. 10.1096/fj.15-276360

  • 20

    ChoY.TachibanaS.HazenB. C.MorescoJ. J.YatesJ. R.KokB.et al (2019). Perm1 regulates CaMKII activation and shapes skeletal muscle responses to endurance exercise training. Mol. Metab.23, 8897. 10.1016/j.molmet.2019.02.009

  • 21

    ChoY.TachibanaS.LamK.AritaY.KhosrowjerdiS.ZhangO.et al (2021). Perm1 promotes cardiomyocyte mitochondrial biogenesis and protects against hypoxia/reoxygenation-induced damage in mice. J. Biol. Chem.297 (1), 100825. 10.1016/j.jbc.2021.100825

  • 22

    ChoiJ. C.WormanH. J. (2013). Reactivation of autophagy ameliorates LMNA cardiomyopathy. Autophagy9 (1), 110111. 10.4161/auto.22403

  • 23

    ChojnowskiA.SobotaR. M.OngP. F.XieW.WongX.DreesenO.et al (2018). 2C-BioID: an advanced two component BioID system for precision mapping of protein interactomes. iScience10, 4052. 10.1016/j.isci.2018.11.023

  • 24

    CuiC.HanS.TangS.HeH.ShenX.ZhaoJ.et al (2020). The autophagy regulatory molecule CSRP3 interacts with LC3 and protects against muscular dystrophy. Int. J. Mol. Sci.21 (3), 749. 10.3390/ijms21030749

  • 25

    CzapiewskiR.RobsonM. I.SchirmerE. C. (2016). Anchoring a leviathan: how the nuclear membrane tethers the genome. Front. Genet.7, 82. 10.3389/fgene.2016.00082

  • 26

    DasS. K.MaL.SharmaN. K. (2015). Adipose tissue gene expression and metabolic health of obese adults. Int. J. Obes. (Lond).39 (5), 869873. 10.1038/ijo.2014.210

  • 27

    de Las HerasJ. I.MeinkeP.BatrakouD. G.SrsenV.ZulegerN.KerrA. R.et al (2013). Tissue specificity in the nuclear envelope supports its functional complexity. Nucleus4 (6), 460477. 10.4161/nucl.26872

  • 28

    DecaudainA.VantyghemM. C.GuerciB.HécartA. C.AuclairM.ReznikY.et al (2007). New metabolic phenotypes in laminopathies: LMNA mutations in patients with severe metabolic syndrome. J. Clin. Endocrinol. Metab.92 (12), 48354844. 10.1210/jc.2007-0654

  • 29

    DepreuxF. F.PuckelwartzM. J.AugustynowiczA.WolfgeherD.LabnoC. M.Pierre-LouisD.et al (2015). Disruption of the lamin A and matrin-3 interaction by myopathic LMNA mutations. Hum. Mol. Genet.24 (15), 42844295. 10.1093/hmg/ddv160

  • 30

    DesgrouasC.VarletA. A.DutourA.GalantD.MeronoF.Bonello-PalotN.et al (2020). Unraveling LMNA mutations in metabolic syndrome: cellular phenotype and clinical pitfalls. Cells9 (2), 310. 10.3390/cells9020310

  • 31

    DittmerT. A.SahniN.KubbenN.HillD. E.VidalM.BurgessR. C.et al (2014). Systematic identification of pathological lamin A interactors. Mol. Biol. Cell25 (9), 14931510. 10.1091/mbc.E14-02-0733

  • 32

    DridiH.WuW.ReikenS. R.OferR. M.LiuY.YuanQ.et al (2021). Ryanodine receptor remodeling in cardiomyopathy and muscular dystrophy caused by lamin A/C gene mutation. Hum. Mol. Genet.29 (24), 39193934. 10.1093/hmg/ddaa278

  • 33

    DuqueG.LiW.YeoL. S.VidalC.FatkinD. (2011). Attenuated anabolic response to exercise in lamin A/C haploinsufficient mice. Bone49, 412418. 10.1016/j.bone.2011.04.023

  • 34

    DutourA.RollP.GaboritB.CourrierS.AlessiM. C.TregouetD. A.et al (2011). High prevalence of laminopathies among patients with metabolic syndrome. Hum. Mol. Genet.20 (19), 37793786. 10.1093/hmg/ddr294

  • 35

    FanJ. R.ChangS. N.ChuC. T.ChenH. C. (2023). AKT2-mediated nuclear deformation leads to genome instability during epithelial-mesenchymal transition. iScience26 (6), 106992. 10.1016/j.isci.2023.106992

  • 36

    FernandezA.BautistaM.WuL.PinaudF. (2022). Emerin self-assembly and nucleoskeletal coupling regulate nuclear envelope mechanics against stress. J. Cell Sci.135 (6), jcs258969. 10.1242/jcs.258969

  • 37

    FerreiraD. M. S.ChengA. J.AgudeloL. Z.CervenkaI.ChaillouT.CorreiaJ. C.et al (2019). LIM and cysteine-rich domains 1 (LMCD1) regulates skeletal muscle hypertrophy, calcium handling, and force. Skelet. Muscle9 (1), 26. 10.1186/s13395-019-0214-1

  • 38

    FlorwickA.DharmarajT.JurgensJ.ValleD.WilsonK. L. (2017). LMNA sequences of 60,706 unrelated individuals reveal 132 novel missense variants in A-type lamins and suggest a link between variant p.G602S and type 2 diabetes. Front. Genet.8, 79. 10.3389/fgene.2017.00079

  • 39

    FongL. G.NgJ. K.LammerdingJ.VickersT. A.MetaM.CotéN.et al (2006). Prelamin A and lamin A appear to be dispensable in the nuclear lamina. J. Clin. Invest.116 (3), 743752. 10.1172/JCI27125

  • 40

    FrankD.FrauenR.HanselmannC.KuhnC.WillR.GantenbergJ.et al (2010). Lmcd1/Dyxin, a novel Z-disc associated LIM protein, mediates cardiac hypertrophy in vitro and in vivo. J. Mol. Cell Cardiol.49 (4), 673682. 10.1016/j.yjmcc.2010.06.009

  • 41

    FrankR.DübelS. (2005). “Analysis of protein interactions with immobilized peptide arrays synthesized on membrane supports, chapter 13,” in Protein-protein interactions. 2nd edition (NY, USA: Cold Spring Harbor Laboratory Press).

  • 42

    FrankR.OverwinH. (1996). Spot synthesis. Epitope analysis with arrays of synthetic peptides prepared on cellulose membranes. Methods Mol. Biol.66, 149169. 10.1385/0-89603-375-9:149

  • 43

    Garin-ShkolnikT.RudichA.HotamisligilG. S.RubinsteinM. (2014). FABP4 attenuates PPARγ and adipogenesis and is inversely correlated with PPARγ in adipose tissues. Diabetes63 (3), 900911. 10.2337/db13-0436

  • 44

    GoC. D.KnightJ. D. R.RajasekharanA.RathodB.HeskethG. G.AbeK. T.et al (2021). A proximity-dependent biotinylation map of a human cell. Nature595 (7865), 120124. 10.1038/s41586-021-03592-2

  • 45

    Guillín-AmarelleC.Sánchez-IglesiasS.MeraA.PintosE.Castro-PaisA.Rodríguez-CañeteL.et al (2018). Inflammatory myopathy in the context of an unusual overlapping laminopathy. Arch. Endocrinol. Metab.62 (3), 376382. 10.20945/2359-3997000000048

  • 46

    HaqueF.MazzeoD.PatelJ. T.SmallwoodD. T.EllisJ. A.ShanahanC. M.et al (2010). Mammalian SUN protein interaction networks at the inner nuclear membrane and their role in laminopathy disease processes. J. Biol. Chem.285 (5), 34873498. 10.1074/jbc.M109.071910

  • 47

    HarrJ. C.LuperchioT. R.WongX.CohenE.WheelanS. J.ReddyK. L. (2015). Directed targeting of chromatin to the nuclear lamina is mediated by chromatin state and A-type lamins. J. Cell Biol.208, 3352. 10.1083/jcb.201405110

  • 48

    HartG. W. (2014). Three decades of research on O-GlcNAcylation—a major nutrient sensor that regulates signaling, transcription and cellular metabolism. Front. Endocrinol.5, 183. 10.3389/fendo.2014.00183

  • 49

    HoffmannC.MoreauF.MoesM.LutholdC.DieterleM.GorettiE.et al (2014). Human muscle LIM protein dimerizes along the actin cytoskeleton and cross-links actin filaments. Mol. Cell Biol.34 (16), 30533065. 10.1128/MCB.00651-14

  • 50

    HolaskaJ. M.LeeK. K.KowalskiA. K.WilsonK. L. (2003). Transcriptional repressor germ cell-less (GCL) and barrier to autointegration factor (BAF) compete for binding to emerin in vitro. J. Biol. Chem.278 (9), 69696975. 10.1074/jbc.M208811200

  • 51

    HolaskaJ. M.Rais-BahramiS.WilsonK. L. (2006). Lmo7 is an emerin-binding protein that regulates the transcription of emerin and many other muscle-relevant genes. Hum. Mol. Genet.15 (23), 34593472. 10.1093/hmg/ddl423

  • 52

    HotamisligilG. S.BernlohrD. A. (2015). Metabolic functions of FABPs--mechanisms and therapeutic implications. Nat. Rev. Endocrinol.11 (10), 592605. 10.1038/nrendo.2015.122

  • 53

    HuangC. Y.OkaS. I.XuX.ChenC. F.TungC. Y.ChangY. Y.et al (2022). PERM1 regulates genes involved in fatty acid metabolism in the heart by interacting with PPARα and PGC-1α. Sci. Rep.12 (1), 14576. 10.1038/s41598-022-18885-3

  • 54

    HuangyangP.LiF.LeeP.NissimI.WeljieA. M.MancusoA.et al (2020). Fructose-1,6-Bisphosphatase 2 inhibits sarcoma progression by restraining mitochondrial biogenesis. Cell Metab.31 (1), 10321188.e7. 10.1016/j.cmet.2020.04.009

  • 55

    IqbalI. K.BajeliS.SahuS.BhatS. A.KumarA. (2021). Hydrogen sulfide-induced GAPDH sulfhydration disrupts the CCAR2-SIRT1 interaction to initiate autophagy. Autophagy17 (11), 35113529. 10.1080/15548627.2021.1876342

  • 56

    JinM.LiuC.HanW.CongY. (2019). TRiC/CCT chaperonin: structure and function. Subcell. Biochem.93, 625654. 10.1007/978-3-030-28151-9_19

  • 57

    KadrmasJ. L.BeckerleM. C. (2004). The LIM domain: from the cytoskeleton to the nucleus. Nat. Rev. Mol. Cell Biol.5 (11), 920931. 10.1038/nrm1499

  • 58

    KamadaK. (2012). “The GINS complex: structure and function,” in The eukaryotic replisome: a guide to protein structure and function, subcellular biochemistry. Editor MacNeillS. (Dordrecht: Springer), 136156. 10.1007/978-94-007-4572-8_8

  • 59

    KammersK.ColeR. N.TiengweC.RuczinskiI. (2015). Detecting significant changes in protein abundance. EuPA Open Proteom7, 1119. 10.1016/j.euprot.2015.02.002

  • 60

    KapiloffM. S.JacksonN.AirhartN. (2001). mAKAP and the ryanodine receptor are part of a multi-component signaling complex on the cardiomyocyte nuclear envelope. J. Cell Sci.114 (17), 31673176. 10.1242/jcs.114.17.3167

  • 61

    KasuyaG.HiraizumiM.MaturanaA. D.KumazakiK.FujiwaraY.LiuK.et al (2016). Crystal structures of the TRIC trimeric intracellular cation channel orthologues. Cell Res.26 (12), 12881301. 10.1038/cr.2016.140

  • 62

    KaukoO.ImanishiS. Y.KulesskiyE.YetukuriL.LaajalaT. D.SharmaM.et al (2020). Phosphoproteome and drug-response effects mediated by the three protein phosphatase 2A inhibitor proteins CIP2A, SET, and PME-1. J. Biol. Chem.295 (13), 41944211. 10.1074/jbc.RA119.011265

  • 63

    KayvanpourE.Sedaghat-HamedaniF.AmrA.LaiA.HaasJ.HolzerD. B.et al (2017). Genotype-phenotype associations in dilated cardiomyopathy: meta-analysis on more than 8000 individuals. Clin. Res. Cardiol.106 (2), 127139. 10.1007/s00392-016-1033-6

  • 64

    KimY.BayonaP. W.KimM.ChangJ.HongS.ParkY.et al (2018). Macrophage lamin A/C regulates inflammation and the development of obesity-induced insulin resistance. Front. Immunol.9, 696. 10.3389/fimmu.2018.00696

  • 65

    KoF.AbadirP.MarxR.WestbrookR.CookeC.YangH.et al (2016). Impaired mitochondrial degradation by autophagy in the skeletal muscle of the aged female interleukin 10 null mouse. Exp. Gerontol.73, 2327. 10.1016/j.exger.2015.11.010

  • 66

    KomakiH.HayashiY. K.TsuburayaR.SugieK.KatoM.NagaiT.et al (2011). Inflammatory changes in infantile-onset LMNA-associated myopathy. Neuromuscul. Disord.21 (8), 563568. 10.1016/j.nmd.2011.04.010

  • 67

    KorfaliN.WilkieG. S.SwansonS. K.SrsenV.BatrakouD. G.FairleyE. A.et al (2010). The leukocyte nuclear envelope proteome varies with cell activation and contains novel transmembrane proteins that affect genome architecture. Mol. Cell Proteomics9 (12), 25712585. 10.1074/mcp.M110.002915

  • 68

    KorfaliN.WilkieG. S.SwansonS. K.SrsenV.de Las HerasJ.BatrakouD. G.et al (2012). The nuclear envelope proteome differs notably between tissues. Nucleus3 (6), 552564. 10.4161/nucl.22257

  • 69

    KreienkampR.GonzaloS. (2020). Metabolic dysfunction in Hutchinson-Gilford progeria syndrome. Cells9 (2), 395. 10.3390/cells9020395

  • 70

    KubbenN.VonckenJ. W.DemmersJ.CalisC.van AlmenG.PintoY.et al (2010). Identification of differential protein interactors of lamin A and progerin. Nucleus1 (6), 513525. 10.4161/nucl.1.6.13512

  • 71

    LeeK. K.HaraguchiT.LeeR. S.KoujinT.HiraokaY.WilsonK. L. (2001). Distinct functional domains in emerin bind lamin A and DNA-bridging protein BAF. J. Cell Sci.114, 45674573. 10.1242/jcs.114.24.4567

  • 72

    LewseyS. C.WeissK.SchärM.ZhangY.BottomleyP. A.SamuelT. J.et al (2020). Exercise intolerance and rapid skeletal muscle energetic decline in human age-associated frailty. JCI Insight5 (20), e141246. 10.1172/jci.insight.141246

  • 73

    LiY.XieM.MenL.DuJ. (2019). O-GlcNAcylation in immunity and inflammation: an intricate system (Review). Int. J. Mol. Med.44 (2), 363374. 10.3892/ijmm.2019.4238

  • 74

    LinE. W.BradyG. F.KwanR.NesvizhskiiA. I.OmaryM. B. (2020). Genotype-phenotype analysis of LMNA-related diseases predicts phenotype-selective alterations in lamin phosphorylation. FASEB J.34 (7), 90519073. 10.1096/fj.202000500R

  • 75

    LiuY.LiY.LiangJ.SunZ.SunC. (2022). Non-histone lysine crotonylation is involved in the regulation of white fat browning. Int. J. Mol. Sci.23 (21), 12733. 10.3390/ijms232112733

  • 76

    Lopez-MejiaI. C.de ToledoM.ChaveyC.LapassetL.CavelierP.Lopez-HerreraC.et al (2014). Antagonistic functions of LMNA isoforms in energy expenditure and lifespan. EMBO Rep.15, 529539. 10.1002/embr.201338126

  • 77

    LuoG.WangR.ZhouH.LiuX. (2021). ALDOA protects cardiomyocytes against H/R-induced apoptosis and oxidative stress by regulating the VEGF/Notch 1/Jagged 1 pathway. Mol. Cell Biochem.476 (2), 775783. 10.1007/s11010-020-03943-z

  • 78

    LuosujärviH.AroJ.TokolaH.LeskinenH.TenhunenO.SkoumalR.et al (2010). A novel p38 MAPK target dyxin is rapidly induced by mechanical load in the heart. Blood Press19 (1), 5463. 10.3109/08037050903464519

  • 79

    MaL.NidadavoluL. S.YangH.LangdonJ.WestbrookR.TsuiB. M. W.et al (2021). Targeted deletion of interleukin-6 in a mouse model of chronic inflammation demonstrates opposing roles in aging: benefit and harm. J. Gerontol. A Biol. Sci. Med. Sci.76 (2), 211215. 10.1093/gerona/glaa156

  • 80

    MakarovA. A.ZouJ.HoustonD. R.SpanosC.SolovyovaA. S.Cardenal-PeraltaC.et al (2019). Lamin A molecular compression and sliding as mechanisms behind nucleoskeleton elasticity. Nat. Commun.10 (1), 3056. 10.1038/s41467-019-11063-6

  • 81

    MalikP.KorfaliN.SrsenV.LazouV.BatrakouD. G.ZulegerN.et al (2010). Cell-specific and lamin-dependent targeting of novel transmembrane proteins in the nuclear envelope. Cell Mol. Life Sci.67 (8), 13531369. 10.1007/s00018-010-0257-2

  • 82

    MalininaA.DikemanD.WestbrookR.MoatsM.GidnerS.PoonyagariyagornH.et al (2020). IL10 deficiency promotes alveolar enlargement and lymphoid dysmorphogenesis in the aged murine lung. Aging Cell19 (4), e13130. 10.1111/acel.13130

  • 83

    MathiesenS. B.LundeM.AronsenJ. M.RomaineA.KaupangA.MartinsenM.et al (2019). The cardiac syndecan-4 interactome reveals a role for syndecan-4 in nuclear translocation of muscle LIM protein (MLP). J. Biol. Chem.294 (22), 87178731. 10.1074/jbc.RA118.006423

  • 84

    MaynardS.HallA.GalanosP.RizzaS.YamamotoT.GramH. H.et al (2022). Lamin A/C impairments cause mitochondrial dysfunction by attenuating PGC1α and the NAMPT-NAD+ pathway. Nucleic Acids Res.50 (17), 99489965. 10.1093/nar/gkac741

  • 85

    McDanielS. L.StrahlB. D. (2017). Shaping the cellular landscape with Set2/SETD2 methylation. Cell Mol. Life Sci.74 (18), 33173334. 10.1007/s00018-017-2517-x

  • 86

    MeinkeP.KerrA. R. W.CzapiewskiR.de Las HerasJ. I.DixonC. R.HarrisE.et al (2020). A multistage sequencing strategy pinpoints novel candidate alleles for Emery-Dreifuss muscular dystrophy and supports gene misregulation as its pathomechanism. EBioMedicine51, 102587. 10.1016/j.ebiom.2019.11.048

  • 87

    MilanD. J.KimA. M.WinterfieldJ. R.JonesI. L.PfeuferA.SannaS.et al (2009). Drug-sensitized zebrafish screen identifies multiple genes, including GINS3, as regulators of myocardial repolarization. Circulation120 (7), 553559. 10.1161/CIRCULATIONAHA.108.821082

  • 88

    MoraitisE.FoleyA. R.PilkingtonC. A.ManzurA. Y.QuinlivanR.JacquesT. S.et al (2015). Infantile-onset LMNA-associated muscular dystrophy mimicking juvenile idiopathic inflammatory myopathy. J. Rheumatol.42 (6), 10641066. 10.3899/jrheum.140554

  • 89

    MorleyJ. E.VellasB.van KanG. A.AnkerS. D.BauerJ. M.BernabeiR.et al (2013). Frailty consensus: a call to action. J. Am. Med. Dir. Assoc.14 (6), 392397. 10.1016/j.jamda.2013.03.022

  • 90

    NaetarN.FerraioliS.FoisnerR. (2017). Lamins in the nuclear interior - life outside the lamina. J. Cell Sci.130 (13), 20872096. 10.1242/jcs.203430

  • 91

    Newton-ChehC.EijgelsheimM.RiceK. M.de BakkerP. I.YinX.EstradaK.et al (2009). Common variants at ten loci influence QT interval duration in the QTGEN Study. Nat. Genet.41 (4), 399406. 10.1038/ng.364

  • 92

    OkaS. I.SreedeviK.ShankarT. S.YedlaS.ArowaS.JamesA.et al (2022). PERM1 regulates energy metabolism in the heart via ERRα/PGC-1α axis. Front. Cardiovasc Med.9, 1033457. 10.3389/fcvm.2022.1033457

  • 93

    ParkS. Y.ParkJ. W.ChunY. S. (2016). Jumonji histone demethylases as emerging therapeutic targets. Pharmacol. Res.105, 146151. 10.1016/j.phrs.2016.01.026

  • 94

    PejanovicN.HochrainerK.LiuT.AerneB. L.SoaresM. P.AnratherJ. (2012). Regulation of nuclear factor κB (NF-κB) transcriptional activity via p65 acetylation by the chaperonin containing TCP1 (CCT). PLoS One7 (7), e42020. 10.1371/journal.pone.0042020

  • 95

    PokharelY. R.SaarelaJ.SzwajdaA.RuppC.RokkaA.Lal Kumar KarnaS.et al (2015). Relevance rank platform (RRP) for functional filtering of high content protein-protein interaction data. Mol. Cell Proteomics14 (12), 32743283. 10.1074/mcp.M115.050773

  • 96

    RamseyK. M.YoshinoJ.BraceC. S.AbrassartD.KobayashiY.MarchevaB.et al (2009). Circadian clock feedback cycle through NAMPT-mediated NAD+ biosynthesis. Science324 (5927), 651654. 10.1126/science.1171641

  • 97

    RathN.WangZ.LuM. M.MorriseyE. E. (2005). LMCD1/Dyxin is a novel transcriptional cofactor that restricts GATA6 function by inhibiting DNA binding. Mol. Cell Biol.25 (20), 88648873. 10.1128/MCB.25.20.8864-8873.2005

  • 98

    RobsonM. I.de Las HerasJ. I.CzapiewskiR.Lê ThànhP.BoothD. G.KellyD. A.et al (2016). Tissue-specific gene repositioning by muscle nuclear membrane proteins enhances repression of critical developmental genes during myogenesis. Mol. Cell62 (6), 834847. 10.1016/j.molcel.2016.04.035

  • 99

    RouxK. J.KimD. I.RaidaM.BurkeB. (2012). A promiscuous biotin ligase fusion protein identifies proximal and interacting proteins in mammalian cells. J. Cell Biol.196 (6), 801810. 10.1083/jcb.201112098

  • 100

    SabatelliP.CastagnaroS.TagliaviniF.ChrisamM.SardoneF.DemayL.et al (2014). Aggresome–autophagy involvement in a sarcopenic patient with rigid spine syndrome and a p. C150R mutation in FHL1 gene. Front. Aging Neurosci.6, 215. 10.3389/fnagi.2014.00215

  • 101

    SamsonC.PetitalotA.CelliF.HerradaI.RoparsV.Le DuM. H.et al (2018). Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies an interface disrupted in autosomal recessive progeroid diseases. Nucleic Acids Res.46 (19), 1046010473. 10.1093/nar/gky736

  • 102

    SchirmerE. C.FlorensL.GuanT.YatesJ. R.3rdGeraceL. (2003). Nuclear membrane proteins with potential disease links found by subtractive proteomics. Science301 (5638), 13801382. 10.1126/science.1088176

  • 103

    SchwarzJ. D.LukassenS.BhandareP.EingL.SnaebjörnssonM. T.GarcíaY. C.et al (2022). The glycolytic enzyme ALDOA and the exon junction complex protein RBM8A are regulators of ribosomal biogenesis. Front. Cell Dev. Biol.10, 954358. 10.3389/fcell.2022.954358

  • 104

    ShiG.WuM.FangL.YuF.ChengS.LiJ.et al (2014). PHD finger protein 2 (PHF2) represses ribosomal RNA gene transcription by antagonizing PHF finger protein 8 (PHF8) and recruiting methyltransferase SUV39H1. J. Biol. Chem.289 (43), 2969129700. 10.1074/jbc.M114.571653

  • 105

    ShimiT.KittisopikulM.TranJ.GoldmanA. E.AdamS. A.ZhengY.et al (2015). Structural organization of nuclear lamins A, C, B1, and B2 revealed by superresolution microscopy. Mol. Biol. Cell26 (22), 40754086. 10.1091/mbc.E15-07-0461

  • 106

    SikkaG.MillerK. L.SteppanJ.PandeyD.JungS. M.FraserC. D.IIIet al (2013). Interleukin 10 knockout frail mice develop cardiac and vascular dysfunction with increased age. Exp. Gerontol.48, 128135. 10.1016/j.exger.2012.11.001

  • 107

    SimonD. N.WilsonK. L. (2013). Partners and post-translational modifications of nuclear lamins. Chromosoma122 (1-2), 1331. 10.1007/s00412-013-0399-8

  • 108

    SimonD. N.WilsonK. L. (2011). The nucleoskeleton as a genome-associated dynamic ‘network of networks’. Nat. Rev. Mol. Cell Biol.12 (11), 695708. 10.1038/nrm3207

  • 109

    SimonD. N.WristonA.FanQ.ShabanowitzJ.FlorwickA.DharmarajT.et al (2018). OGT (O-GlcNAc transferase) selectively modifies multiple residues unique to lamin A. Cells7, 44. 10.3390/cells7050044

  • 110

    SimonD. N.ZastrowM. S.WilsonK. L. (2010). Direct actin binding to A- and B-type lamin tails and actin filament bundling by the lamin A tail. Nucleus1, 264272. 10.4161/nucl.1.3.11799

  • 111

    SouèsS.KannM. L.FouquetJ. P.MelkiR. (2003). The cytosolic chaperonin CCT associates to cytoplasmic microtubular structures during mammalian spermiogenesis and to heterochromatin in germline and somatic cells. Exp. Cell Res.288 (2), 363373. 10.1016/s0014-4827(03)00248-9

  • 112

    StenderJ. D.PascualG.LiuW.KaikkonenM. U.DoK.SpannN. J.et al (2012). Control of proinflammatory gene programs by regulated trimethylation and demethylation of histone H4K20. Mol. Cell48 (1), 2838. 10.1016/j.molcel.2012.07.020

  • 113

    SunR. C.DukhandeV. V.ZhouZ.YoungL. E. A.EmanuelleS.BrainsonC. F.et al (2019). Nuclear glycogenolysis modulates histone acetylation in human non-small cell lung cancers. Cell Metab.30 (5), 903916. 10.1016/j.cmet.2019.08.014

  • 114

    SunZ.TongG.MaN.LiJ.LiX.LiS.et al (2013). NDRG2: a newly identified mediator of insulin cardioprotection against myocardial ischemia-reperfusion injury. Basic Res. Cardiol.108, 341. 10.1007/s00395-013-0341-5

  • 115

    TanakaK. I.KanazawaI.RichardsJ. B.GoltzmanD.SugimotoT. (2020). Modulators of Fam210A and roles of Fam210A in the function of myoblasts. Calcif. Tissue Int.106, 533540. 10.1007/s00223-020-00661-y

  • 116

    TanakaK. I.XueY. B.Nguyen-YamamotoL.MorrisJ. A.KanazawaI.SugimotoT.et al (2018). FAM210A is a novel determinant of bone and muscle structure and strength. PNAS115, E3759E3768. 10.1073/pnas.1719089115

  • 117

    ThompsonA.SchaferJ.KuhnK.KienleS.SchwarzJ.SchmidtG.et al (2003). Tandem mass tags: a novel quantification strategy for comparative analysis of complex protein mixtures by MS/MS. Anal. Chem.75 (8), 18951904. 10.1021/ac0262560

  • 118

    TracyC.WarrenJ. S.SzulikM.WangL.GarciaJ.MakajuA.et al (2018). The Smyd family of methyltransferases: role in cardiac and skeletal muscle physiology and pathology. Curr. Opin. Physiol.1, 140152. 10.1016/j.cophys.2017.10.001

  • 119

    TrajanoskaK.MorrisJ. A.OeiL.ZhengH. F.EvansD. M.KielD. P.et al (2018). Assessment of the genetic and clinical determinants of fracture risk: genome wide association and mendelian randomisation study. BMJ362, k3225. 10.1136/bmj.k3225

  • 120

    TsunZ. Y.Bar-PeledL.ChantranupongL.ZoncuR.WangT.KimC.et al (2013). The folliculin tumor suppressor is a GAP for the RagC/D GTPases that signal amino acid levels to mTORC1. Mol. Cell52 (4), 495505. 10.1016/j.molcel.2013.09.016

  • 121

    UnoK.ShimadaS.TsurutaJ.MatsuzakiH.TashimaS.OgawaM. (1998). Nuclear localization of brain-type glycogen phosphorylase in some gastrointestinal carcinoma. Histochem J.30 (8), 553559. 10.1023/a:1003239302471

  • 122

    van SteenselB.BelmontA. S. (2017). Lamina-associated domains: links with chromosome architecture, heterochromatin, and gene repression. Cell169 (5), 780791. 10.1016/j.cell.2017.04.022

  • 123

    WalstonJ.FedarkoN.YangH.LengS.BeamerB.EspinozaS.et al (2008). The physical and biological characterization of a frail mouse model. J. Gerontol. A Biol. Sci. Med. Sci.63 (4), 391398. 10.1093/gerona/63.4.391

  • 124

    WestbrookR.ChungT.LovettJ.WardC.JocaH.YangH.et al (2020). Kynurenines link chronic inflammation to functional decline and physical frailty. JCI Insight5 (16), e136091. 10.1172/jci.insight.136091

  • 125

    WestbrookR. M.YangH. L.LangdonJ. M.RoyC. N.KimJ. A.ChoudhuryP. P.et al (2017). Aged interleukin-10tm1Cgn chronically inflamed mice have substantially reduced fat mass, metabolic rate, and adipokines. PLoS One12 (12), e0186811. 10.1371/journal.pone.0186811

  • 126

    WongX.HoskinsV. E.Melendez-PerezA. J.HarrJ. C.GordonM.ReddyK. L. (2021b). Lamin C is required to establish genome organization after mitosis. Genome Biol.22 (1), 305. 10.1186/s13059-021-02516-7

  • 127

    WongX.LuperchioT. R.ReddyK. L. (2014). NET gains and losses: the role of changing nuclear envelope proteomes in genome regulation. Curr. Opin. Cell Biol.28, 105120. 10.1016/j.ceb.2014.04.005

  • 128

    WongX.Melendez-PerezA. J.ReddyK. L. (2021a). The nuclear lamina. Cold Spring Harb. Perspect. Biol.16, a040113. 10.1101/cshperspect.a040113

  • 129

    WormanH. J.SchirmerE. C. (2015). Nuclear membrane diversity: underlying tissue-specific pathologies in disease?Curr. Opin. Cell Biol.34, 101112. 10.1016/j.ceb.2015.06.003

  • 130

    WuJ.Venkata SubbaiahK. C.JiangF.HedayaO.MohanA.YangT.et al (2021). MicroRNA-574 regulates FAM210A expression and influences pathological cardiac remodeling. EMBO Mol. Med.13 (2), e12710. 10.15252/emmm.202012710

  • 131

    XiaW.-R.FuW.WangQ.ZhuX.XingW.-W.WangM.et al (2017). Autophagy induced FHL2 upregulation promotes IL-6 production by activating the NF-κB pathway in mouse aortic endothelial cells after exposure to PM2.5. Int. J. Mol. Sci.18, 1484. 10.3390/ijms18071484

  • 132

    XieW.ChojnowskiA.BoudierT.LimJ. S.AhmedS.SerZ.et al (2016). A-Type lamins form distinct filamentous networks with differential nuclear pore complex associations. Curr. Biol.26, 26512658. 10.1016/j.cub.2016.07.049

  • 133

    XingY.LiZ.ChenY.StockJ. B.JeffreyP. D.ShiY. (2008). Structural mechanism of demethylation and inactivation of protein phosphatase 2A. Cell133 (1), 154163. 10.1016/j.cell.2008.02.041

  • 134

    XueQ. L.TianJ.WalstonJ. D.ChavesP. H. M.NewmanA. B.Bandeen-RocheK. (2020). Discrepancy in frailty identification: move beyond predictive validity. J. Gerontol. A Biol. Sci. Med. Sci.75 (2), 387393. 10.1093/gerona/glz052

  • 135

    ZastrowM. S.FlahertyD. B.BenianG. M.WilsonK. L. (2006). Nuclear titin interacts with A- and B-type lamins in vitro and in vivo. J. Cell Sci.119 (2), 239249. 10.1242/jcs.02728

  • 136

    ZhangJ. J.FanT. T.MaoY. Z.HouJ. L.WangM.ZhangM.et al (2021). Nuclear dihydroxyacetone phosphate signals nutrient sufficiency and cell cycle phase to global histone acetylation. Nat. Metab.3 (6), 859875. 10.1038/s42255-021-00405-8

  • 137

    ZhengM.JinG.ZhouZ. (2022). Post-Translational modification of lamins: mechanisms and functions. Front. Cell Dev. Biol.10, 864191. 10.3389/fcell.2022.864191

  • 138

    ZhouX.LinP.YamazakiD.ParkK. H.KomazakiS.ChenS. R.et al (2014). Trimeric intracellular cation channels and sarcoplasmic/endoplasmic reticulum calcium homeostasis. Circ. Res.114 (4), 706716. 10.1161/CIRCRESAHA.114.301816

  • 139

    ZiatE.MamchaouiK.BeuvinM.NelsonI.AzibaniF.SpulerS.et al (2016). FHL1B interacts with lamin A/C and emerin at the nuclear lamina and is misregulated in emery-dreifuss muscular dystrophy. J. Neuromuscul. Dis.3 (4), 497510. 10.3233/JND-160169

  • 140

    ZulegerN.BoyleS.KellyD. A.de las HerasJ. I.LazouV.KorfaliN.et al (2013). Specific nuclear envelope transmembrane proteins can promote the location of chromosomes to and from the nuclear periphery. Genome Biol.14 (2), R14. 10.1186/gb-2013-14-2-r14

Summary

Keywords

lamin A, Emery-Dreifuss muscular dystrophy, Fam210a, Perm1, AldoA, Lmcd1, Tmem38a, Phf2

Citation

Elzamzami FD, Samal A, Arun AS, Dharmaraj T, Prasad NR, Rendon-Jonguitud A, DeVine L, Walston JD, Cole RN and Wilson KL (2023) Native lamin A/C proteomes and novel partners from heart and skeletal muscle in a mouse chronic inflammation model of human frailty. Front. Cell Dev. Biol. 11:1240285. doi: 10.3389/fcell.2023.1240285

Received

14 June 2023

Accepted

05 October 2023

Published

23 October 2023

Volume

11 - 2023

Edited by

Kundan Sengupta, Indian Institute of Science Education and Research, Pune, India

Reviewed by

Kaushik Sengupta, Saha Institute of Nuclear Physics (SINP), India

Eric C. Schirmer, University of Edinburgh, United Kingdom

Updates

Copyright

*Correspondence: Katherine L. Wilson,

‡These authors have contributed equally to this work

† Present Address: Adith S. Arun, Yale School of Medicine, New Haven, CT, United States Tejas Dharmaraj, Division of Infectious Diseases and Geographic Medicine, Department of Medicine, Stanford University School of Medicine, Stanford, CA, United States Alex Rendon-Jonguitud, Medical University of South Carolina, Charleston, SC, United States

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics