Abstract
The Solanaceae is an important plant family that has been playing an essential role in traditional medicine and human nutrition. Members of the Solanaceae are rich in bioactive metabolites and have been used by different tribes around the world for ages. Antimicrobial peptides (AMPs) from plants have drawn great interest in recent years and raised new hope for developing new antimicrobial agents for meeting the challenges of antibiotic resistance. This review aims to summarize the reported AMPs from plants of the Solanaceae with possible molecular mechanisms of action as well as to correlate their traditional uses with reported antimicrobial actions of the peptides. A systematic literature study was conducted using different databases until August 2019 based on the inclusion and exclusion criteria. According to literature, a variety of AMPs including defensins, protease inhibitor, lectins, thionin-like peptides, vicilin-like peptides, and snaking were isolated from plants of the Solanaceae and were involved in their defense mechanism. These peptides exhibited significant antibacterial, antifungal and antiviral activity against organisms for both plant and human host. Brugmansia, Capsicum, Datura, Nicotiana, Salpichora, Solanum, Petunia, and Withania are the most commonly studied genera for AMPs. Among these genera, Capsicum and the Solanum ranked top according to the total number of studies (35%–38% studies) for different AMPs. The mechanisms of action of the reported AMPs from Solanaceae was not any new rather similar to other reported AMPs including alteration of membrane potential and permeability, membrane pore formation, and cell aggregation. Whereas, induction of cell membrane permiabilization, inhibition of germination and alteration of hyphal growth were reported as mechanisms of antifungal activity. Plants of the Solanaceae have been used traditionally as antimicrobial, insecticidal, and antiinfectious agents, and as poisons. The reported AMPs from the Solanaceae are the products of chemical shields to protect plants from microorganisms and pests which unfold an obvious link with their traditional medicinal use. In summary, it is evident that AMPs from this family possess considerable antimicrobial activity against a wide range of bacterial and fungal pathogens and can be regarded as a potential source for lead molecules to develop new antimicrobial agents.
Introduction
Misuse or overuse of antibiotics is now becoming the major contributing factor for the ever-increasing antimicrobial resistance (). Discovery of new effective antimicrobial agents has become a dire need to combat antibiotic resistance which is posing as one of the biggest threat to global health. Since ancient time, natural products have been playing an essential role around the world to treat human diseases as well as a potential source of new therapeutic agents because of their unique and immense chemical diversity (Amedeo ). Ethnopharmacology, a multidisciplinary study of indigenous remedies, has a great significance on discovery of new drug from natural sources (Holmstedt and Bruhn, 1983).
It is well known that plants can develop different constitutive and inducible mechanisms for the protection from pathogenic infection via morphological barriers, secondary metabolites or antimicrobial peptides (AMPs) (). AMPs belong to a wide range of protein family that act as a part of innate immune system or barrier defense of all higher living organisms (; ; ). In recent years, AMPs are getting interest as a surrogate of conventional antibiotics because of their significant activity against multidrug resistant organisms by their direct action on microorganisms or stimulating immune responses (Marshall and Arenas, 2003; Pushpanathan et al., 2013; Mahlapuu et al., 2016). Natural AMPs are reported to possess low to no toxicity in humans and are stable in various conditions because of their unique features including disulfide bonds, overall charges, and especial structural conformation (; ). Exceptional features of AMPs make them potential candidate to develop new antimicrobial agents. About 1,500 AMPs have been identified from natural sources and a number of these are presently under clinical or preclinical trials (e.g. kalata B1 and B2, pexiganan, omiganan, novexatin, thionins, and thioneinetc) (Salas et al., 2015; Molchanova et al., 2017; ). Plants are a promising source of AMPs and a number of these peptides have been identified from different parts of plant (leaves, roots, seeds, flowers, and stems) that demonstrated significant activity against both human pathogen or phytopathogens (Montesinos, 2007; ; Nawrot et al., 2014). Being discovered from plant, they might have possible link with their ethno-medicinal uses against infection or other ailment.
The Solanaceae is an important family both for economic plants and medicinal plants. Potato, tomato, eggplant, and peppers are some of the most important cash crops that belong to the family of Solanaceae (). On the other hand Atropa, Hyoscymus, Withania, Capsicum, and Nicotiana are just some of the most important Solanaceae plants that dictated early stages of medicinal plant based drug discovery and still considered important in herbal practice (). The Solanaceae family consists of about 2,700 species distributed in 98 genera (Olmstead and Bohs, 2006). The Solanaceae is a family of flowering plants that ranges from annual and perennial herbs to vines, shrubs, and trees with their distribution in (Nath et al., 2017) almost all continents except Antarctica (Yadav et al., 2016). The Solanaceae are rich in alkaloids some of which finds their use in different traditional medicinal systems including Ayurveda, Traditional Chinese Medicine (TCM), Siddha, Unani, and homeopathy (Shah et al., 2013; ) especially for their use as antimicrobial, insecticidal, antiinfectious agents, and as poisons (Niño et al., 2006; Shah et al., 2013; ; Tamokou et al., 2017). Bioactive secondary metabolites reported from the members of the Solanaceae include AMPs, alkaloids, flavonoids, glycosides, lactones, lignans, steroids, simple phenols, sugars, and terpenoids (). AMPs of plant origins act as chemical shields to protect plants from organisms and pests that directs to an interesting prospect of AMPs for possible use as promising molecules in antiinfective therapy (). Literature study showed that a number of bioactive AMPs have been reported from different plant parts of the Solanaceae which confirmed the presence of such molecule in this family (Segura et al., 1999; Ryan and Pearce, 2003; Poth et al., 2012; Meneguetti et al., 2017; Kaewklom et al., 2018). However, there is no focused review of AMPs from plants of the Solanaceae to-date, despite their potential as natural antibiotics or antimicrobial agents. The aim of this review is to summarize the reported AMPs from plants of Solanaceae and to draw a possible molecular mechanism of action to further correlate the traditional uses of these plants with their reported AMPs.
Search Strategy and Data Extraction
In this review, a comprehensive literature search was conducted using Google Scholar, PubMed, Science Direct, Scopus and Web of Science databases with the term “Solanaceae” along with “peptide,” “protein,” “AMP,” “antimicrobial,” “antifungal,” “antibacterial,” and “antiviral.” We have considered the reports that were only in English because of language barrier, time efficiency and nonfeasible costs of translation. Criteria for inclusion of investigation in this review: (a) peptides isolated from the plants of the Solanaceae, (b) studies those include the antimicrobial effects of peptide or peptide extract from the Solanaceae, (c) studies with peptide concentrations or doses employed, (d) studies of isolated peptides mass and sequence, (e) studies with mechanisms of action associated with their isolated peptides or peptide rich extracts. For the data extraction, all the retrieved articles were assessed according to surname of first author, publication year, the Solanaceae plants, peptides isolated and their mass, sequences, antimicrobial activity, concentrations used, and molecular mechanism involved. From the literature search, it was found that among all the genera of the Solanaceae, Capsicum and Solanum genera are more abundant with AMPs (Figure 1).
Figure 1
AMPs From Plants of the Solanaceae Family
AMPs from plants are considered as barrier defensive chemicals that have protective response to predators like bacteria, fungi, nematodes, insects, and pests (Nawrot et al., 2014). Based on features, AMPs are grouped into different classes such as type of charge, disulfide bonds present, cyclic structure and the mechanism of action. Cyclotide, defensins, hevein-like proteins, knotin-type proteins, lipid transfer proteins, protease inhibitor, snakins, and thionins were the common classes of AMPs reported so far (Kim et al., 2009; ). Among these peptides defensins, protease inhibitor, lectins, thionin-like peptide, vicilin-like peptide, snaking, and some other AMPs were isolated and identified from Solanaceae. Isolated peptides and peptide rich extracts of plants from the Solanaceae exerted antimicrobial activity against various strains of bacteria, fungi, and viruses. Tables 1 and 2 summarize the antimicrobial activity of peptide rich extract and isolated peptides from Solanaceae.
Table 1
| Genus | Plant name | Protein/Peptide (Class/Name) | Mass (kDa) | Sequence | Activity | MIC/MBC/IC50 | Microorganism | Mechanism of action | Ref. |
|---|---|---|---|---|---|---|---|---|---|
| Capsicum | Capsicum annuum L. | Peptide rich extracts | 5–12 | NA | Antifungal | 50 μg/ml | C. gloeosporioides | Inhibits the growth and hyphae formation | (Maracahipes et al., 2019) |
| CWE1 peptide- extracts (leaf) | 10 | NA | Antibacterial | 10 µg/ml 20 µg/ml 17.4 μg/ml | R. solanacearum, C. michiganensis E. carotovora ssp | NA | () | ||
| Antifungal | NA | A. solani | |||||||
| Capsicum baccatum var. pendulum (Willd.) Eshbaugh | Trypsin inhibitors rich leaf extract | 10–14 | Cb1= GFPFLLNGPDQDQGDFIMFG Cb-1′= GFKGEQGVPQEMQNEQATIP | Antiviral | 1 μg/ml | Pepper yellow | Inhibits the activity of pathogen-derived proteinase by binding to and, thus, blocking its active site, suppressing enzymatic activity | (Moulin et al., 2014) | |
| Capsicum frutescens L. | Antimicrobial peptide rich leaf and fruit extract | NA | NA | Antibacterial | 250 mg/ml | E coli S. aureus K. pneumonia | NA | () | |
| Antifungal | 5 mg/ml | Alternaria, Colletotrichum Fusarium | |||||||
| Datura | Datura stramonium L. | 9–45 | NA | Antibacterial | NA | E. coli K. pneumoniae | Binds to GlcNAc (N-acetyl glucosamine) oligomers which is responsible for the bacterial recognition. | (Muhammad et al., 2019) | |
| Solanum . | Solanum marginatum L. | Protein rich extract (leaves) | 18–112 | NA | Antibacterial | 0.1–10 µg/ml | E. coli S. aureus, P. aeruginosa S. choleraesuis | NA | () |
| Solanum stramonifolium Jacq. | Protease inhibitors rich extracts (seed) | 10– 21.5 | NA | Antibacterial | 100 µg/disc | S. aureus B. licheniformis B. subtilis X. sp. P. aeruginosa S. typhi | NA | (Sarnthima and Khammuang, 2012) |
Antimicrobial activity of peptide rich plants extract from Solanaceae family.
E. coli, Escherichia coli; K. pneumonia, Klebsiella pneumonia; S. aureus, Stapyllococcus aureus; B. licheniformis, Bacillus licheniformis; B. subtilis, Bacillus subtilis; P. aeruginosa, Pseudomonas aeruginosa; S. typhi, Salmonella typhi; S. choleraesuis, Salmonella choleraesuis; C. gloeosporioides, Colletotrichum gloeosporioides; R. solanacearum, Ralstonia solanacearum; C. michiganensis, Clavibacter michiganensis; E. carotovora ssp, Erwinia. carotovora ssp; A. solani, Alternaria solani; A. Colletotrichum, Alternaria Colletotrichum.
Table 2
| Genus | Plant name | Protein/Peptide (Class/Name) | Mass (kDa) | Sequence | Activity | MIC/MBC/IC50 | Microorganism | Mechanism of action | Ref. |
|---|---|---|---|---|---|---|---|---|---|
| Brugmansia | Brugmansia x candida Pers. | Defensin | 5.29 | FSGGDCRGLRRRCFCTR-NH2 | Antibacterial | 15.70 μM | E. coli V. cholerae S. sonnei S. typhimurium E. faecalis B. cereus S. epidermidis | Affects cell membrane potential and permeability, and causes cell membrane disruption | (Kaewklom et al., 2018) |
| Capsicum | Capsicum annuum L. | Trypsin inhibitor | ~ 20 | NA | Antifungal | 64 μg/ml | F. solani C. gloeosporioides C. lindemuthianum F. oxysporum | Causes hyphal morph–ological alterations, membrane permeabili- -zation via induces reactive oxygen species. | (Silva et al., 2017) |
| Thionin-like peptide | 5 | NA | Antifungal | 10 μg/ml, 20 μg/ml 40 μg/ml | Candida species | Causes plasma membrane permeabilization in all yeasts tested and induces oxidative stresses only in Candida tropicalis | (Taveira et al., 2016) | ||
| Thionin-like peptides | 7–10 | NA | Antibacterial | 100 µg/ml | P. aeruginosa E. coli | Induces change in the membranes of all strains, leading to their permeabilization | (Taveira et al., 2014) | ||
| Antifungal | 100 µg/ml | S. cerevisiae C. albicans C. tropicalis | |||||||
| Antimicrobial CaAMP1 protein | 21.152 | NA | Antibacterial | 10 µg/ml, >100 µg/ml | B. subtilis M. luteus | NA | (Lee et al., 2008) | ||
| Antifungal | 30 µg/ml, 20 µg/ml, 5 µg/ml, 10 µg/ml, 5 µg/ml, >100 µg/ml, 50 µg/ml, 50 µg/ml | C. albicans B. cinerea C. cucumerinum P. capsici S. cerevisiae, R. solani A. brassicicola F. oxysporum | Inhibition of fungal spore germination and hyphae growth | ||||||
| Capsicum baccatum L. | Vicilin-like peptides | 4–8 | NA | Antifungal | 200 µg/ml | S. cerevisiae C. albicans C. tropicalis K. marxiannus | Promotes morpholo-logical changes in all strains, including pseudohyphae formation | () | |
| Capsicum chinense Jacq. | Trypsin -chymotrypsin protease inhibitor | 5.0–14 | PEF2-A= QICTNCCAGRKGCNYYSAD PEF2-B= GICTNCCAGRKGCNYFSAD | Antifungal | 100 µg/ml | C. albicans, P. membranifaciens S. cerevisiae C. tropicalis K. marxiannus | Exhibits cellular agglomeration and formation of pseudohyphae | () | |
| DING Peptide | 7.57 And 39 | ~ 7.57 kDa =lengths of 32 (AGTNAVDLSVDQLCGVTSGRITTWNQLPATGR), 21 (ITYMSPDYAAPTLAGLDDATK), and 12 (RSASGTTELFTR) ~ 39 kDa= ITYMSPDYAAPTLAGLDDATK | Antifungal | 3.75 µg/ml | S. cerevisiae | NA | () | ||
| Datura | Datura innoxia Mill. | Chito-specific Lectin | 9 | NA | Antibacterial | 0.325 mg/ml 0.25 mg/ml 0.15 mg/ml 0.5 mg/ml | S. aureus B. cereus E. faecalis E. coli S. typhimurium P. aeruginosa | NA | (Singh and Suresh, 2016) |
| Antifungal | NA | C. albicans T. viride G. saubinetii F. oxysporum C. sp S. cerevisiae F. moniliforme A. sfalvus | |||||||
| Nicotiana | Nicotiana alata Link & Otto. | Defensin (class I NaD1 and II NaD2) | 11.72 | MARSLCFMAF AILAMMLFVA YEVQARECKT ESNTFPGICI TKPPCRKACI SEKFTDGHCS KILRRCLCTK PCVFDEKMTK TGAEILAEEA KTLAAALLEE EIMDN | Antifungal | NaD1= 1μM, 0.5 μM, 0.75 μM, 1 μM, 0.8 μM, 2.5 μM, 2 μM NaD2= 5 μM, 2μM, >10 μM, 7 μM, 5 μM, 4 μM, 5 μM | F. oxysporum F. graminearum V. dahlia T. basicola A. nidulans P. coronate P. sorghi | Inhibits germination, stunting of germ tubes and a granular appearance of the cytoplasm in spores, reduces pustule frequency and increased photosynthetic area | () |
| Defensin | 5–7 | Antifungal | 10 µg/ml 2 µg/ml | B. cinerea F. oxysporum | Inhibits the hyphal growth | (Lay et al., 2003) | |||
| Nicotiana tabacum L. | CBP20 Peptide | 20 | (CBP-PEP1): Y(A/G)SPSQGXQSQ(R)SGGGGGGGGGGGGGAGN (CBP-PEP2): TAFYGPVGP(P/R)GRDSXGK(G) | Antifungal | 6.7 µg/ml | F. solani T. viride A. radicina | Causes lysis of the germ tubes | (Ponstein et al., 1994) | |
| Petunia | Petunia violacea var. hybridaHook. (syn. Petunia hybrida Vilm.) | Defensin | 5 -7 | NA | Antifungal | 10 µg/ml 2 µg/ml | B. cinerea F. oxysporum | Inhibits the hyphal growth | (Lay et al., 2003) |
| Solanum | Solanum lycopersicum L. | Defensin | 5.3–8.7 | NA | Antifungal | 2.5 µg/ml | B. cinerea | Inhibits hyphal tip growth | (Stotz et al., 2009) |
| Snakin-2 peptide | 7.05 | NA | Antibacterial | 4.25 µM 1.06 µM .26 µM 1.06 µM | E. coli, A. tumefaciens M. luteus S. cohnii | Perforates the biomembranes of bacteria and fungi | (Herbel et al., 2015) | ||
| Antifungal | 8.49 µM 4.25 µM | P. pastoris, F. solani | |||||||
| Solanum tuberosum L. cv Jaerla | Snakin-2 peptide | 7.02 | NA | Antibacterial | 1 µM 30 µM 8 µM | C. michiganensis R. solanacearum R. meliloti | Induces rapid aggregation of both gm(+) and gm (−) bacteria | () | |
| Antifungal | 2 µM 3 µM 2 µM 10 µM 20 µM 10 µM 10 µM 10 µM 20 µM | B. cinerea F. solani F. culmorum F. oxysporum A. flavus C. graminicola P. cucumerina C. lagenarium B. maydis | NA | ||||||
| Solanum aethiopicum L. (syn. Solanum integrifolium Poir.) | Chitin-binding lectin | 16.8 | MKTIQGQSATTALTMEVARVQA | Antifungal | 1 mg/ml 5 mg/ml | R. solani C. gloeosporioides | Inhibits the rate of the growth of fungal hyphae | () | |
| Insecticidal | 1 μg/ml | sf21 insect cells | Reduces the mitochondrial membrane potential in insect cells | ||||||
| Solanum tuberosum L. | Serine protease inhibitor | 13.5 | NH2-LPSDATLVLDQTGKELDARL | Antifungal | 6.25 µg/ml 6.25 µg/ml 6.25 µg/ml >100 µg/ml >100 µg/ml >100 µg/ml | S. cerevisiae T. beigelii C. albicans C. gloeosporioides C. coccodes D. bryoniae | NA | (Park et al., 2005) | |
| Trypsin-chymotrypsin protease inhibitor | 5.6 | NH2-DICTCCAGTKGCNTTSANGAFICEGQSDPKKPKACPLNCDPHIAYA | Antibacterial | 50 µM | C. michiganense | Inhibits the growth of both types of microorganism. | (Kim et al., 2005) | ||
| Antifungal | 100 µM | C. albicans R. solani | |||||||
| Apoplastic hydrophobic peptides (AHPs) | 12–78 | NA | Antifungal | 25 µM | P. infestans | Inhibits the germination of hyphae and accelerates the destruction of fungal spores | () | ||
| Potide-G | 5.57 | NA | Antiviral | 90 µM | P. Virus | NA | (Tripathi et al., 2006) | ||
| Salpichroa | Salpichroa origanifolia (Lam.) Baill. | Aspartic protease inhibitor | 32 | NA | Antifungal | 1.2 µM | F. solani | Causes permeabilization of cell membranes | () |
| Antibacterial | 1.9 µM 2.5 µM | E. coli S. aureus | |||||||
| Withania | Withania somnifera L. Dunal. | Lectin-like peptide | 30 | NA | Antifungal | 7 μg/ml 9 μg/ml 11 μg/ml | T. vesiculosum F. moniliforme M. phaseolina R. solani | Inhibits the hyphal extension | () |
| Glycoprotein (WSG) | 28 | NA | Antibacterial | 20 µg/ml | C. michiganensis | Inhibits bacterial growth | () | ||
| Antifungal | A. flavus F. oxysporum, F. verticilloides | Exerts a fungistastic effect by inhibiting spore germination and hyphal growth |
Antimicrobial activity of isolated peptides from plants of Solanaceae family.
A. brassicicola, Alternaria brassicicola; A. tumefaciens, Agrobacteriumtumefaciens; A. radicina, Alternaria radicina; A. flavus, Aspergillus flavus; B. cinereal, Botrytis cinerea; B. subtilis, Bacillus subtilis; B. graminis, Blumeria graminis; B. cinerea, Botrytis cinerea; B. cereus, Bacillus cereus; B. cereus, Bacillus cereus; C. sp, Cephalosporium sp; C. cucumerinum, Cladosporiumcucumerinum; C. albicans, Candida albicans; C. tropicalis, Candida tropicalis; C.michiganensis, Clvibacter michiganensis; C. gloeosporioides, Colletotrichum gloeosporioides; C. occodes, Colletotrichum coccodes; C. michiganense, Clavibacter michiganense; C. lindemuthianum, Colletotrichum lindemuthianum; C. tropicalis, Candida tropicalis; D. bryoniae, Didymella bryoniae; E. faecalis, Enterococcus faecalis; E. coli, Escherichia coli; F. solani, Fusarium solani; F. graminearum, Fusariumgraminearum; F.moniliforme, Fusariummoniliforme; F. oxysporum, Fusariumoxysporum; F. verticilloides, Fusariumverticilloides; G. saubinetii, Gibberella saubinetii; K. marxiannus, Kluyveromyces marxiannus; M. phaseolina, Macrophomia phaseolina; M. luteus, Micrococcus luteus; P. infestans, Phytophthora infestans; P. Virus, Potato Virus; P. graminis, Puccinia graminis; P. capsica, Phytophthora capsici; P. triticina, Puccinia triticina; P. hordei, Puccinia hordei; P. striiformis, Puccinia striiformis; P. coronate, Puccinia coronate; P. aeruginosa, Pseudomonas aeruginosa; P. nodorum, Phaeosphaeria nodorum; R. solani, Rhizoctonia solani; R.meliloti, Rhizobiummeliloti; S. sonnei, Shigella sonnei; S. typhimurium, Salmonella typhimurium; S. epidermidis, Staphylococcus epidermidis; S. cerevisiae, Saccharomyces cerevisiae; S. aureus, Staphylococcus aureus; S. cohnii, Staphylococcus cohnii; T. vesiculosum, Trichosporium vesiculosum; T. viride, Trichoderma viride; T. controversa, Tilletia controversa; T. beigelii, Trichosporon beigelii; U. tritici, Ustilago tritici; V. cholera, Vibrio cholera; NA, Not available.
Several genera of the Solanaceae, such as Capsicum, Datura, and Solanum, have been reported to possess AMPs and peptide rich extract from seeds, leaf or fruit, tuber of these species. These peptides have been reported to have significant antibacterial, antifungal, or antiviral activities against both phytopathogenic and human pathogenic strain (Table 1). The reported AMP rich extracts belong to different categories include acidic, basic, protease inhibitor, and trypsin inhibitors (Sarnthima and Khammuang, 2012; Moulin et al., 2014; Muhammad et al., 2019). The mechanism of their action was not clear, however, it was reported that antibacterial activity could be due to changes in membrane permeabilization (Muhammad et al., 2019) and antifungal activity could be owing to inhibition of fungal growth and hyphae formation (Maracahipes et al., 2019). The Datura is a common genus of the Solanaceae and mostly found in Asian continent with a number of ethnomedicinal uses including against microbial infections (Table 3). Recently, Muhammad et al. (2019) reported that the seed extract of Datura stramonium L. is rich in acidic and basic peptides (9–45 kDa) and exhibited antibacterial activity against Escherichia coli and Klebsiella pneumonia (; Muhammad et al., 2019). Antibacterial activity of peptide rich extract from the leaves of Solanum stramonifolium Jacq. and seeds of Solanum marginatum L.f. showed antibacterial activity against different human pathogenic bacteria with the MIC values 0.1–100 µg/ml (Sarnthima and Khammuang, 2012; ). Peptide rich leaf and seed extracts of different species of the Capsicum, e.g., Capsicum annuum L. and Capsicum frutescens L., exhibited significant antibacterial and antifungal effect via inhibiting their growth and hyphae formation (; ; Maracahipes et al., 2019). A study by Moulin et al. (2014) showed that trypsin inhibitors (10–14 kDa) rich leaf extract of Capsicum baccatum var. pendulum (Willd.) Eshbaugh exerted antiviral activity (MIC 1–25 µg/ml) against PepYMV (Pepper yellow mosaic virus) by blocking the active site of pathogen-derived proteinase as well as reduced enzymatic activity (Moulin et al., 2014). The genera Capsicum, Datura, and Solanum of the Solanaceae are popular in ethnobotany and have been reported to have different traditional uses against different diseases including infections (Table 3) which might be linked to the AMPs found in these plants.
Table 3
| Plant name | Traditional uses | References |
|---|---|---|
| Brugmansia x candida Pers. | Used as analgesic against traumatic or rheumatic pains as well as for the treatment of dermatitis, orchitis, arthritis, headaches, infections, and as an antiinflammatory. | () |
| Capsicum annuum L. | Used to prevent cold, sinus infection, sorethroat and improve digestion, blood circulation, cancer, asthma, and cough, norexia, haemor-rhoids, liver congestion, and varicose veins. | (; Khare, 2004) |
| Capsicum baccatum L. | Antirheumatic, antiseptic, diaphoretic, digestive, irritant, rubefacient, sialagogue and tonic | (; ) |
| Capsicum chinense Jacq | Asthma, gastro-intestinal abnormalities, toothache and muscle pain, removal of puss from boils, arthritis | (Roy, 2016) |
| Capsicum frutescens L. | Antihaemorrhoidal, antirheumatic, antiseptic, carminative, diaphoretic, digestive, sialagogue and stomachic, antibiotic properties. | (; Simpson and Conner-Ogorzaly, 1986; ) |
| Datura stramonium L. | Used to treat epilepsy burns and rheumatism, anthelmintic, and antiinflammatory, worm infestation, toothache, and fever, insect repellant, which protects neighboring plants from insects. | (; ; Soni et al., 2012) |
| Datura innoxia Mill. | Used in the treatment of insanity, fevers with catarrh, diarrhea, and skin diseases. | (; ) |
| Nicotiana alata Link & Otto. | Used as antiseptic, insecticide, antispasmodic, relieve pain, and swelling associated with rheumatic conditions and vermifuge. | () |
| Solanum lycopersicum L. | First aid treatment for burns, scalds and sunburn, treatment of toothache | () |
| Solanum tuberosum L. | Folk remedy for burns, corns, cough, cystitis, fistula, prostatitis, scurvy, spasms, tumors, and warts | (; ) |
| Salpichroa origanifolia (Lam.) Baill. | Used as antiinflammatory, diuretic, antimicrobial and narcotic effect | (Parisi et al., 2018) |
| Withania somnifera (L.) Dunal. | Aphrodisiac, sedative, chronic fatigue, weakness, dehydration, weakness of bones and loose teeth, thirst, impotence, premature aging, emaciation, debility and muscles tension, antihelmantic. | (Mir et al., 2012) |
Traditional uses of plants from Solanaceae family.
Plant defensins are cysteine rich small (45 to 54 amino acids) basic peptides that can form four structure-stabilizing disulfide bridges (). They have a widespread distribution and are likely to be present in the Solanaceae. Kaewklom et al. (2018) reported a new plant defensin (5.29 kDa) with interesting structural and biological features from Brugmansia x candida Pers. that showed antibacterial activity (MIC of 15.7 μM) against Bacillus cereus, Enterococcus faecalis, E. coli, Shigella sonnei, Salmonella typhimurium, Staphylococcus epidermidis, and Vibrio cholerae, by affecting membrane permeability, membrane potential, and membrane disruption (Kaewklom et al., 2018). Different types of defensin were found in Nicotiana alata Link & Otto that inhibit germination and the hyphal growth of fungus (Lay et al., 2003; ) (Figure 2). Antifungal defensins were also found from Solanum lycopersicum L. and Petunia violacea var. hybrida Hook. (syn. Petunia hybrida Vilm.) with MICs of 2.5–11 µg/ml against Botrytis cinerea and Fusarium oxysporum through inhibition of hyphal tip growth (Stotz et al., 2009). Interestingly, B. x candida, N. alata, S. lycopersicum, and P. hybrida have long been used traditionally for treating various diseases which is justified by the defensin content of these plant species of Solanaceae.
Figure 2
Proteinase inhibitors are another class of plant peptides that reported to possesses antibacterial and antifungal activity (; ; Kim et al., 2009). Plant protease inhibitors are commonly found in tubers and seeds and known to inhibit aspartic, cysteine, and serine proteinases. Increased levels of trypsin and chymotrypsin inhibitors in plants have a strong correlation with their resistance to the pathogen (Kim et al., 2009). Solanum tuberosum L. is a common species of the Solanaceae and different protease inhibitor-like AMPs have been reported from this species. Park et al. (2005) and Kim et al. (2005) reported trypsin-chymotrypsin and serine protease inhibitor-like peptides from Solanum tuberosum and both demonstrated potential antifungal activity with MICs 1–25 µg/ml (Kim et al., 2005; Park et al., 2005). Among these peptides, iskunitz-type serine protease inhibitor was reported to be active against Candida albicans, Colletotrichum gloeosporioides, Colletotrichum coccodes, Didymella bryoniae, Saccharomyces cerevisiae, and Trichosporon beigelii fungal infections whereas the other one trypsin-chymotrypsin protease inhibitor was active against C. albicans and Rhizoctonia solani. The genus Capsicum produces trypsin and trypsin-chymotrypsin protease inhibitor like peptides with antifungal activity (MIC 50-250 µg/ml), particularly from C. annuum and C. chinense Jacq. (; Silva et al., 2017). The antifungal activity of these AMPs exhibited either through cellular agglomeration and formation of pseudohyphae or via hyphal morphological alterations as well as membrane permeabilization by inducing ROS (; Silva et al., 2017). Salpichroa origanifolia is another plant of the Solanaceae from which another aspartic protease inhibitor AMP has been reported that possesses both antifungal (0.3–3.75 µM) and antibacterial (0.32.5 µM) activity against Fusarium solani, E. coli, and Staphylococcus aureus via membrane permeabilization (). Interestingly, Capsicum, Salpichroa, and Solanum are well known genera of the Solanaceae and have been used in traditional medicine against a number of infectious diseases (Table 3).
Lectins are carbohydrate binding proteins, widely distributed in plants, animals, or microorganisms and have specificity for cell surface sugar moieties of glycoconjugates residues (). Plant lectins have been reported to a wide variety of flowering plant species (). The Solanaceae is a family of flowering plants and a number of lectins have been reported from different plants from this family (Table 2). Antimicrobial action of lectins has long been known and the reported lectins from the Solanaceae also possess antibacterial and antifungal activity. A chito-specific lectin (9 kDa) was purified and characterized from Datura innoxia Mill. seeds that was shown to have antibacterial and antifungal activity at different concentrations against various strains of bacteria (MICs 0.25–0.5 mg/ml) and fungi (MIC 0.15 mg/ml) (Singh and Suresh, 2016). Lectin-like protein (30 kDa) was isolated from Withania somnifera (L.) Dunal that showed antimicrobial effect (MIC 7-11 μg/ml) (; ). Recently, , reported a chitin-specific lectin from Solanum aethiopicum L. (syn. Solanum integrifolium) with antifungal (MIC 1–5 mg/ml) and insecticidal activities (MIC 1 μg/ml) (). Another monomeric glycoprotein (28 kDa) was reported from W. somnifera root tubers which showed significant antimicrobial activity against phytopathogns (both fungi and bacteria) (). The antifungal activity of reported lectins were due to the inhibition of growth and extension of fungal hypha (; ; ). These plants have been reported to have traditional uses against different infections (Table 3) which might have correlation with the reported AMPs from these plants.
Thionins are another AMPs that are structurally cystine-rich, disulfide bond containing cationic small peptides (∼5 kDa) found in plant and act as a part of plant defense mechanisms (Westermann and Craik, 2010). It is reported that thionins possess cidal effect to a broad range of bacteria and mammalian cells through loss of membrane integrity and induces membrane permeabilization mechanisms (Montville and Kaiser, 1993; Westermann and Craik, 2010). Literature study demonstrated that C. annuum was a potential plant with thionins that showed antimicrobial activity against a broad ranges of human pathogens both bacteria (MIC 100–300 mg/ml) and fungi (MIC 10–40 µg/ml). The possible mechanism of action includes induced membrane permiabilization or changes in membrane integrity as well as induced oxidative stress (Taveira et al., 2014; Taveira et al., 2016). Interestingly, the Capsicum is one of the potential genera of the Solanaceae that has been used traditionally against a number of infectious diseases (Table 3).
Vicilins are 7S globulin class plant seed storage proteins with no disulfide bond and structurally contain three similar subunits of 40–70 kDa (). These proteins possess different functions and known as plant defense proteins (Jain et al., 2016). Vicilin-like peptides have similar homology with vicilin and exhibited antimicrobial and antifungal activity (Ribeiro et al., 2007; Jain et al., 2016). Capsicum baccatum L. has been reported to produce vicilin-like peptides that showed promising antifungal activity (MIC 100–200 µg/ml) (). The possible mechanism of their antifungal activity was not clear but highlighted that the antifungal action was due to promotion of cellular morphological changes including pseudohyphae formation through binding of chitin containing components of fungal cell wall ().
Snakins are plant AMPs that have twelve conserved cysteine residues and play different roles in plant with the responses of both biotic and abiotic stress. These plant peptides have been reported to offer a number of activities including significant antibacterial activity and therefore have potential therapeutic and agricultural applications (Oliveira-Lima et al., 2017). The Solanum genus is rich in snakin-2 peptide that possesses significant antimicrobial activity. Herbel et al. (2015) revealed that recombinant snakin-2 (7.05 kDa) protein in E. coli from Solanum lycopersicum caused perforation of membranes of bacteria and fungi with MIC values 0.26–8.49 µM (Herbel et al., 2015). Another snakin-2 peptide (7.02 kDa) was isolated from potato tuber (S. tuberosum ) that showed promising activity against phytopathogenic bacteria (MICs 1–30 µM) and fungi (MIC 1–20 µM). The mechanism of action of snakins remains unclear, however the antibacterial activity was reported due to the rapid aggregation of bacterial cells ().
In addition to these common plant AMPs, some other peptides or polypeptides with significant antimicrobial activity have also been reported from plants of the Solanaceae (Table 2). reported a ~7.57 kDa peptide with interesting antifungal (MIC 3–15 µg/ml) and antiproliferative activity from C. chinense seeds, which were further confirmed a proteolytic product belonging to a ~ 39 kDa DING protein (). DING protein is a class of ubiquitous protein (40 kDa) that possesses phosphatase and inhibition of carcinogenic cell growth activity () (Figure 2). A study conducted by Ponstein et al. (1994) demonstrated the purification of a new pathogen and wound-inducible polypeptide (CBP20) from tobacco leaves (Nicotiana tabacum) with antifungal activity (Ponstein et al., 1994) (Figure 2). A number of apoplastic hydrophobic proteins (AHPs) with antifungal activity identified after differentially expressed by Phytophthora infestans infection to potato tuber (S. tuberosum) that help to protect potato against P. infestans infection (). Inhibition of germination of hyphae and fungal spore was the possible mechanism of AHPs’s antifungal activity (). In 2006, two antiviral peptides named potide-G and golden peptide were isolated separately from potato (S. tuberosum L.) that showed promising antiviral activity against potato virus YO (PVYO) (Tripathi et al., 2006). Another study with C. annum found a new antimicrobial protein CaAMP1 that exhibited promising activity against both different bacteria (MICs 5–30 µg/ml) and fungi (MICs 5–100 µg/ml). The antifungal activity was due to inhibition of spore germination and hyphae growth (Lee et al., 2008). Some other peptides belonging to different AMPs families such as defensins, thionin, protease inhibitor, hevein-type were also reported from S. tuberosum., C. annuum. and Solanum esculentum L. of the Solanaceae that showed no antibacterial activity (; ; Kovtun et al., 2018). Solanum, Capsicum, Nicotiana, and Withania were the most ethnobotanical genera of the Solanaceae that have different traditional uses against different diseases including antimicrobial activity (Table 3) which could have correlation with these reported plant defensive AMPs.
AMPs have been studied for several decades but understanding of their molecular mechanism is still unclear. However, it is evident that AMPs are plant defense peptides that act against pathogen (both bacteria and fungi) to protect themselves by interacting with their cell wall. AMPs can act through several mechanism depending on peptides structure, amino acid sequence, peptide-lipid ratio as well as properties of the interacting lipid membrane (; ). It is evident that interaction of peptides with cell membrane causes changes in peptide’s conformation and aggregation state that adapted by membrane lipid via alteration of their (lipid) conformation and packing structure (). Both Gram-positive and Gram-negative bacteria contain negatively charged surfaces on outer membrane (Gram-negative) or cell wall (Gram-positive) and therefore there was no basic mechanistic difference of AMPs acting on them. Furthermore, Gram-positive bacterial cell wall contain pores (40 to 80 nm) and several AMPs easily cross it to interact with target site (Malanovic and Lohner, 2016). Sani and Separovic (2016) proposed a number of membrane models (barrel-stave pore, toroidal pore and carpet model) associated with cationic AMPs-membrane interaction, membrane disruption and membrane permiability (Sani and Separovic, 2016). In case of Gram-negative bacteria, AMPs cross membrane through electrostatic interaction and charge-exchange mechanism with Ca2+ and Mg2+ bound to lipopolysaccharide and peptidoglycan (Schmidt and Wong, 2013; ). The mechanism of antibacterial action of peptides from Solanaceae were due to the induction of membrane pores, alteration of cell membrane potential and permeability as well as cell aggregation which support the reported AMPs mechanism of action. Whereas, antifungal AMPs can specifically target fungi cell wall or cell membrane and ergosterol is the major component in fungal cell membranes which regulates permeability and fluidity (Silva et al., 2014; Rodrigues, 2018). AMPs also exert their antifungal activity by inhibition of β-glucan synthase resulting in destabilized cell wall and cell lysis (Matejuk et al., 2010). The alteration of hyphal growth by AMPs was due to inhibition of cell wall biosynthesis (Theis et al., 2003). Interestingly, reported Solanaceae AMP’s antifungal activity were supported by the molecular mechanism such as induction of cell membrane permiabilization, inhibition of germination, and alteration of hyphal growth.
Conclusion
In this review, we have summarized the reported AMPs from plants of the Solanaceae and pointed out the possible molecular mechanisms to correlate the ethnobotanical uses with their antimicrobial action. These data demonstrated that a variety of AMPs have been isolated with significant antimicrobial activity from plants of the Solanaceae including defensins, protease inhibitor, lectins, thionin-like peptide, vicilin-like peptide, snaking, and others. Capsicum, Solanum, Datura, Nicotiana, Withania, Salpichora, Brugmansia, and Petunia are the most promising genera to produce different AMPs. Alteration of cell membrane potential and permeability as well as membrane pores induction and cell aggregation were the possible antibacterial mechanism of the reported peptides. On the other hand, the antifungal activity was due to induction of cell membrane permeabilization, inhibition of germination and alteration of hyphal growth. However, the mechanisms of action of the AMPs from Solanaceae were not any new pathway rather similar to other generic AMPs. The isolated and identified AMPs from the Solanaceae are a part of its defense mechanism and are therefore have strong correlation with their ethnobotanical virtues including antimicrobial, poisonous, insecticidal, and antiinfectious. The Solanaceae contain a variety of AMPs with promising antimicrobial activity that may be a potential source of lead for antimicrobial drug development. In addition to pharmaceutical uses, AMPs from Solanaceae can also be a good source for development of innovative approaches for plant protection in agriculture. Conferred disease resistance by AMPs might help us surmount losses in yield, quality and safety of agricultural products as well as molecular farming due to their disease resistance properties. Furthermore, new species from Solanaceae could be interesting to be explored for novel AMPs.
Statements
Author contributions
The review was designed by SU and written by SU, MA, SA, AA, and RR. JS, ET, SS, AA, and UG provided valuable guidance, revision, correction, and other insight into the work.
Acknowledgments
All the authors are thankful to Pharmacy Discipline, Life Science School, Khulna University and Ministry of Education, Bangladesh for their assistance and support.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
References
1
AllenN. K.BrilliantineL. (1969). A Survey of Hemagglutinins in Various Seeds. J. Immunol.102, 1295–1299.
2
AmedeiA.Niccolai.E. (2014). “Plant and Marine Sources: Biological activity of natural products and therapeutic use,” in Natural Product Analysis: Instrumentation, Metods and Applicatoins. Eds. HavlicekV.J. Spizekgf (New Jersy, USA: John Wiley and Sons, Inc.), 43.
3
AnunthawanT.De La Fuente-NunezC.HancockR. E.KlaynongsruangS. (2015). Cationic amphipathic peptides KT2 and RT2 are taken up into bacterial cells and kill planktonic and biofilm bacteria. Biochim. Biophys. Acta1848, 1352–1358. doi: 10.1016/j.bbamem.2015.02.021
4
Barbosa PelegriniP.Del SartoR. P.SilvaO. N.FrancoO. L.Grossi-De-SaM. F. (2011). Antibacterial peptides from plants: what they are and how they probably work. Biochem. Res. Int.2011, 250349. doi: 10.1155/2011/250349
5
BardV. G. C.NascimentoV. V.OliveiraA. E. A.RodriguesR.CunhaD. M.DiasG. B.et al. (2014). Vicilin-like peptides from Capsicum baccatum L. seeds are α-amylase inhibitors and exhibit antifungal activity against important yeasts in medical mycology. Pept. Sci.102, 335–343. doi: 10.1002/bip.22504
6
BechingerB.GorrS. U. (2017). Antimicrobial Peptides: Mechanisms of Action and Resistance. J. Dent. Res.96, 254–260. doi: 10.1177/0022034516679973
7
Benko-IsepponA. M.GaldinoS. L.CalsaT.Jr.KidoE. A.TossiA.BelarminoL. C.et al. (2010). Overview on plant antimicrobial peptides. Curr. Protein Pept. Sci.11, 181–188. doi: 10.2174/138920310791112075
8
Berrocal-LoboM.SeguraA.MorenoM.LopezG.Garcia-OlmedoF.MolinaA. (2002). Snakin-2, an antimicrobial peptide from potato whose gene is locally induced by wounding and responds to pathogen infection. Plant Physiol.128, 951–961. doi: 10.1104/pp.010685
9
BinorkarS. V.JaniD. K. (2012). Traditional medicinal usage of tobacco- a review. Spatula D.D.2, 127–134. doi: 10.5455/spatula.20120423103016
10
BondarykM.StaniszewskaM.ZielińskaP.Urbańczyk-LipkowskaZ. (2017). Natural antimicrobial peptides as inspiration for design of a new generation antifungal compounds. J. Fungi (Basel Switzerland)3, 46. doi: 10.3390/jof3030046
11
BooklandM. J.DarbinianN.WeaverM.AminiS.KhaliliK. (2012). Growth inhibition of malignant glioblastoma by DING protein. J. Neurooncol.107, 247–256. doi: 10.1007/s11060-011-0743-x
12
BownD. (1995). The Royal Horticultural Society encyclopedia of herbs & their uses (New York: Dorling Kindersley Limited).
13
Brito-ArgáezL.Tamayo-SansoresJ. A.Madera-PiñaD.García-VillalobosF. J.Moo-PucR. E.Kú-GonzálezÁ.et al. (2016). Biochemical characterization and immunolocalization studies of a Capsicum chinense Jacq. protein fraction containing DING proteins and anti-microbial activity. Plant Physiol. Biochem.109, 502–514. doi: 10.1016/j.plaphy.2016.10.031
14
BroekaertW. F.CammueB. P.De BolleM. F.ThevissenK.De SamblanxG. W.OsbornR. W.et al. (1997). Antimicrobial peptides from plants. Crit. Rev. Plant Sci.16, 297–323. doi: 10.1080/07352689709701952
15
BrooksS. A.LeathemA. J. (1998). Expression of N-acetyl galactosaminylated and sialylated glycans by metastases arising from primary breast cancer. Inva. Metast.18, 115–121. doi: 10.1159/000024504
16
CamposM. L.De SouzaC. M.De OliveiraK. B. S.DiasS. C.FrancoO. L. (2018). The role of antimicrobial peptides in plant immunity. J. Exp. Bot.69, 4997–5011. doi: 10.1093/jxb/ery294
17
Carrillo-MontesJ. P.Arreguín-EspinosaR.Muñoz-SánchezJ. L.Soriano-GarcíaM. (2014). Purification and biochemical characterization of a protease inhibitor II family from Jalapeno pepper (Capsicum annuum L.). Adv. Biosci. Biotechnol.5, 661. doi: 10.4236/abb.2014.57078
18
ChandraH.BishnoiP.YadavA.PatniB.MishraA. P.NautiyalA. R. (2017). Antimicrobial resistance and the alternative resources with special emphasis on plant-based antimicrobials-A Review. Plants (Basel)6, 16. doi: 10.3390/plants6020016
19
ChenC.-S.ChenC.-Y.RavinathD. M.BungahotA.ChengC.-P.YouR.-I. (2018). Functional characterization of chitin-binding lectin from Solanum integrifolium containing anti-fungal and insecticidal activities. BMC Plant Biol.18, 3. doi: 10.1186/s12870-017-1222-0
20
ChevallierA. (1996). The encyclopedia of medicinal plants (USA: DK Publisher).
21
ChiejR. (1984). The Macdonald encyclopedia of medicinal plants (Macdonald & Co (Britain: Publishers) Ltd).
22
ChopraR. N.ChopraR. N. (1969). Supplement to glossary of Indian medicinal plants (New Delhi, India: Council for scientific and industrial research).
23
ChowanskiS.AdamskiZ.MarciniakP.RosinskiG.BuyukguzelE.BuyukguzelK.et al. (2016). A review of bioinsecticidal activity of Solanaceae Alkaloids. Toxins (Basel)8, 1–28. doi: 10.3390/toxins8030060
24
DíazM.RochaG.KiseF.RossoA.GuevaraM.ParisiM. (2018). Antimicrobial activity of an aspartic protease from Salpichroa origanifolia fruits. Lett. Appl. Microbiol.67, 168–174. doi: 10.1111/lam.13006
25
DasS.KumarP.BasuS. (2012). Phytoconstituents and therapeutic potentials of Datura stramonium Linn. J. Drug Deliv. Ther.2, 4–7. doi: 10.22270/jddt.v2i3.141
26
DevS. S.VenuA. (2016). Isolation and screening of antimicrobial peptides from Kanthari Mulaku (Capsicum frutescens). Int. J. Pharma. Bio Sci.7, 174–179.
27
DiamondG.BeckloffN.WeinbergA.KisichK. O. (2009). The roles of antimicrobial peptides in innate host defense. Curr. Pharma. Des.15, 2377–2392. doi: 10.2174/138161209788682325
28
DiasG. B.GomesV. M.PereiraU. Z.RibeiroS. F. F.CarvalhoA. O.RodriguesR.et al. (2013). Isolation, characterization and antifungal activity of proteinase inhibitors from Capsicum chinense Jacq. seeds. Protein J.32, 15–26. doi: 10.1007/s10930-012-9456-z
29
DracatosP. M.Van Der WeerdenN. L.CarrollK. T.JohnsonE. D.PlummerK. M.AndersonM. A. (2014). Inhibition of cereal rust fungi by both class I and II defensins derived from the flowers of N icotiana alata. Mol. Plant Pathol.15, 67–79. doi: 10.1111/mpp.12066
30
DukeJ.WainK. (1981). “Medicinal plants of the world. Computer index with more than 85000 entries,” in Handbook of Medicinal Herbs (Florida, Boca Raton: CRC press), 96.
31
DukeJ. A. (1993). CRC handbook of alternative cash crops (Florida: CRC press).
32
DukeJ. A. (2008). Duke’s handbook of medicinal plants of Latin America (Florida: CRC press).
33
EftekharF.YousefzadiM.TafakoriV. (2005). Antimicrobial activity of Datura innoxia and Datura stramonium. Fitoterapia76, 118–120. doi: 10.1016/j.fitote.2004.10.004
34
EmbodenW. (1972). Narcotic plants, hallucinogens, stimulants, inebriants and hypnotics-their origins and uses (Faraday CI, United Kingdom: Littlehampton Book Services Ltd).
35
EpandR. M.VogelH. J. (1999). Diversity of antimicrobial peptides and their mechanisms of action. Biochim. Biophys. Acta1462, 11–28. doi: 10.1016/S0005-2736(99)00198-4
36
FeoV. D. (2004). The ritual use of Brugmansia species in Traditional Andean Medicine in Northern Peru. Eco. Bot.58 (Supp.), S221–S229. doi: 10.1663/0013-0001(2004)58[S221:TRUOBS]2.0.CO;2
37
FernándezM. B.PaganoM. R.DaleoG. R.GuevaraM. G. (2012). Hydrophobic proteins secreted into the apoplast may contribute to resistance against Phytophthora infestans in potato. Plant Physiol. Biochem.60, 59–66. doi: 10.1016/j.plaphy.2012.07.017
38
GaldieroS.FalangaA.CantisaniM.VitielloM.MorelliG.GaldieroM. (2013). Peptide-lipid interactions: experiments and applications. Int. J. Mol. Sci.14, 18758–18789. doi: 10.3390/ijms140918758
39
GamesP.Koscky-PaierC.Almeida-SouzaH.BarbosaM.AntunesP.CarrijoL.et al. (2013). In vitro anti-bacterial and anti-fungal activities of hydrophilic plant defence compounds obtained from the leaves of bell pepper (Capsicum annuum L.). J. Hortic. Sci. Biotechnol.88, 551–558. doi: 10.1080/14620316.2013.11513005
40
GhatakA.ChaturvediP.PaulP.AgrawalG. K.RakwalR.KimS. T.et al. (2017). Proteomics survey of Solanaceae family: Current status and challenges ahead. J. Proteomics169, 41–57. doi: 10.1016/j.jprot.2017.05.016
41
GhoshM. (2009). Purification of a lectin-like antifungal protein from the medicinal herb, Withania somnifera. Fitoterapia80, 91–95. doi: 10.1016/j.fitote.2008.10.004
42
GirishK.MachiahK.UshanandiniS.Harish KumarK.NagarajuS.GovindappaM.et al. (2006). Antimicrobial properties of a non-toxic glycoprotein (WSG) from Withania somnifera (Ashwagandha). J. Basic Microbiol.46, 365–374. doi: 10.1002/jobm.200510108
43
GründemannC.StenbergK. G.GruberC. W. (2019). T20K: An immunomodulatory cyclotide on its way to the clinic. Int. J. Pept. Res. Therap.25, 9–13. doi: 10.1007/s10989-018-9701-1
44
GrahamJ.QuinnM.FabricantD.FarnsworthN. (2000). Plants used against cancer–an extension of the work of Jonathan Hartwell. J. Ethnopharmacol.73, 347–377. doi: 10.1016/S0378-8741(00)00341-X
45
GuarreraP. M. (1999). Traditional antihelmintic, antiparasitic and repellent uses of plants in Central Italy. J. Ethnopharmacol.68, 183–192. doi: 10.1016/S0378-8741(99)00089-6
46
GuevaraM. G.DaleoG. R.OlivaC. R. (2001). Purification and characterization of an aspartic protease from potato leaves. Physiol. Plant112, 321–326. doi: 10.1034/j.1399-3054.2001.1120304.x
47
Guzmán-CeferinoJ.Cobos-PucL.Sierra-RiveraC.EsquivelJ. C. C.Durán-MendozaT.Silva-BelmaresS. (2019). Partial characterization of the potentially bioactive protein fraction of Solanum marginatum L. f. Polibotánica9 (47), 137–151. doi: 10.18387/polibotanica.47.10
48
HancockR. E.LehrerR. (1998). Cationic peptides: a new source of antibiotics. Trends Biotechnol.16, 82–88. doi: 10.1016/S0167-7799(97)01156-6
49
HancockR. E. (2001). Cationic peptides: effectors in innate immunity and novel antimicrobials. Lancet Infect. Dis.1, 156–164. doi: 10.1016/S1473-3099(01)00092-5
50
HerbelV.SchäferH.WinkM. (2015). Recombinant production of snakin-2 (an antimicrobial peptide from tomato) in E. coli and analysis of its bioactivity. Molecules20, 14889–14901. doi: 10.3390/molecules200814889
51
HolmstedtB.BruhnJ. G. (1983). Ethnopharmacology: A Challenge. J. Ethnopharmacol.8, 251–256. doi: 10.1016/0378-8741(83)90062-4
52
JainA.KumarA.SalunkeD. M. (2016). Crystal structure of the vicilin from Solanum melongena reveals existence of different anionic ligands in structurally similar pockets. Sci. Rep.6, 23600. doi: 10.1038/srep23600
53
KaewklomS.WongchaiM.PetvisesS.HanpithakphongW.AunpadR. (2018). Structural and biological features of a novel plant defensin from Brugmansia x candida. PloS One13, e0201668. doi: 10.1371/journal.pone.0201668
54
KhareC. P. (2004). Indian herbal remedies: Rational Western therapy, ayurvedic, and other traditional usage, Botany (Berlin: Springer-Verleg), 523.
55
KimJ.-Y.ParkS.-C.KimM.-H.LimH.-T.ParkY.HahmK.-S. (2005). Antimicrobial activity studies on a trypsin–chymotrypsin protease inhibitor obtained from potato. Biochem. Biophys. Res. Commun.330, 921–927. doi: 10.1016/j.bbrc.2005.03.057
56
KimJ.-Y.ParkS.-C.HwangI.CheongH.NahJ.-W.HahmK.-S.et al. (2009). Protease inhibitors from plants with antimicrobial activity. Int. J. Mol. Sci.10, 2860–2872. doi: 10.3390/ijms10062860
57
KovtunA.IstominaE.SlezinaM.OdintsovaT. (2018). Identification of antimicrobial peptides in Lycopersicon esculentum genome, in: Paper presented at the International Conference on Mathematical Biology and Bioinformatics, Pushchino, Moscow Region, Russia. doi: 10.17537/icmbb18.13
58
LayF. T.BruglieraF.AndersonM. A. (2003). Isolation and properties of floral defensins from ornamental tobacco and petunia. Plant Physiol.131, 1283–1293. doi: 10.1104/pp.102.016626
59
LeeS. C.HwangI. S.ChoiH. W.HwangB. K. (2008). Involvement of the pepper antimicrobial protein CaAMP1 gene in broad spectrum disease resistance. Plant Physiol.148, 1004–1020. doi: 10.1104/pp.108.123836
60
MahlapuuM.HåkanssonJ.RingstadL.BjörnC. (2016). Antimicrobial Peptides: An Emerging Category of Therapeutic Agents. Front. Cell. Infect. Microbiol.6, 194–194. doi: 10.3389/fcimb.2016.00194
61
MalanovicN.LohnerK. (2016). Gram-positive bacterial cell envelopes: The impact on the activity of antimicrobial peptides. Biochim. Biophys. Acta1858, 936–946. doi: 10.1016/j.bbamem.2015.11.004
62
MaracahipesÁ. C.TaveiraG. B.MelloE. O.CarvalhoA. O.RodriguesR.PeralesJ.et al. (2019). Biochemical analysis of antimicrobial peptides in two different Capsicum genotypes after fruit infection by Colletotrichum gloeosporioides. Biosci. Rep.39, BSR20181889. doi: 10.1042/BSR20181889
63
MarshallS. H.ArenasG. (2003). Antimicrobial peptides: A natural alternative to chemical antibiotics and a potential for applied biotechnology. Elec. J. Biotechnol.6, 271–284. doi: 10.2225/vol6-issue3-fulltext-1
64
MatejukA.LengQ.BegumM. D.WoodleM. C.ScariaP.ChouS. T.et al. (2010). Peptide-based Antifungal Therapies against Emerging Infections. Drugs Fut.35, 197–197. doi: 10.1358/dof.2010.035.03.1452077
65
MeneguettiB. T.MachadoL. S.OshiroK. G. N.NogueiraM. L.CarvalhoC. M. E.FrancoO. L. (2017). Antimicrobial peptides from fruits and their potential use as biotechnological tools—A Review and Outlook. Front. Microbiol.7 (2136), 1–13. doi: 10.3389/fmicb.2016.02136
66
MirB. A.KhazirJ.MirN. A.HasanT.-U.KoulS. (2012). Botanical, chemical and pharmacological review of Withania somnifera (Indian ginseng): an ayurvedic medicinal plant. Indian J. Drugs Dis.1, 147–160.
67
MolchanovaN.HansenP. R.FranzykH. (2017). Advances in development of antimicrobial peptidomimetics as potential drugs. Molecules22, 1–60. doi: 10.3390/molecules22091430
68
MontesinosE. (2007). Antimicrobial peptides and plant disease control. FEMS Microbiol. Lett.270, 1–11. doi: 10.1111/j.1574-6968.2007.00683.x
69
MontvilleT. J.KaiserA. L. (1993). “CHAPTER 1 - Antimicrobial Proteins: Classification, Nomenclature, Diversity, and Relationship to Bacteriocins,” in Bacteriocins of Lactic Acid Bacteria. Eds. HooverD. G.Steenson.L. R. (San Diego, California: Academic Press), 1–22.
70
MoulinM.RodriguesR.RibeiroS.GonçalvesL.BentoC.SudréC.et al. (2014). Trypsin inhibitors from Capsicum baccatum var. pendulum leaves involved in Pepper yellow mosaic virus resistance. Gen. Mol. Res.13, 9229–9243. doi: 10.4238/2014.November.7.10
71
MuhammadS. M.SaboI. A.GumelA. M.FatimaI. (2019). Extraction and purification of antimicrobial proteins from Datura Stramonium Seed. J. Adv. Biotechnol.18, 1073–1077. doi: 10.24297/jbt.v8i0.8221
72
NathP.YadavA. K.SorenA. D. (2017). Sub-acute toxicity and genotoxicity assessement of the rhizome extract of Acorus calamus L., A medicinal plant of India. Eur. J. Pharm. Med. Res.4, 392–399.
73
NawrotR.BarylskiJ.NowickiG.BroniarczykJ.BuchwaldW.Goździcka-Józefiak,. A. (2014). Plant antimicrobial peptides. Folia Microbiol.59, 181–196. doi: 10.1007/s12223-013-0280-4
74
NiñoJ.CorreaY.MosqueraO. (2006). Antibacterial, antifungal, and cytotoxic activities of 11 Solanaceae plants from Colombian biodiversity. Pharm. Biol.44, 14–18. doi: 10.1080/13880200500509124
75
Oliveira-LimaM.Benko-IsepponA. M.NetoJ.Rodriguez-DecuadroS.KidoE. A.CrovellaS.et al. (2017). Snakin: Structure, roles and applications of a plant antimicrobial peptide. Curr. Protein Pept. Sci.18, 368–374. doi: 10.2174/1389203717666160619183140
76
OlmsteadR. G.BohsL. (2006). “A summary of molecular systematic research in Solanaceae: 1982-2006,” in VI International Solanaceae Conference: Genomics Meets Biodiversity 745, (Beljium: International Society for Horticultural Science (ISHS)), 255–268.
77
ParisiM.OrtizC.HernándezM. D. L. C.PanecaM.RossoA. (2018).Biopreparations of Salpichroa Origanifolia for the control of pests and diseases affecting crops of economical interest, in: International Concerence: Centro de Bioplantas, Cuba.
78
ParkY.ChoiB. H.KwakJ.-S.KangC.-W.LimH.-T.CheongH.-S.et al. (2005). Kunitz-type serine protease inhibitor from potato (Solanum tuberosum L. cv. Jopung). J. Agric. Food Chem.53, 6491–6496. doi: 10.1021/jf0505123
79
PonsteinA. S.Bres-VloemansS. A.Sela-BuurlageM. B.Van Den ElzenP. J.MelchersL. S.CornelissenB. J. (1994). A novel pathogen-and wound-inducible tobacco (Nicotiana tabacum) protein with antifungal activity. Plant Physiol.104, 109–118. doi: 10.1104/pp.104.1.109
80
PothA. G.MylneJ. S.GrasslJ.LyonsR. E.MillarA. H.ColgraveM. L.et al. (2012). Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem.287 (32), 27033–27046. doi: 10.1074/jbc.M112.370841
81
PushpanathanM.GunasekaranP.RajendhranJ. (2013). Antimicrobial peptides: versatile biological properties. Int. J. Pept.2013 (675391), 1–15. doi: 10.1155/2013/675391
82
RibeiroS. F. F.AgizzioA. P.MachadoO. L. T.Neves-FerreiraA. G. C.OliveiraM. A.FernandesK. V. S.et al. (2007). A new peptide of melon seeds which shows sequence homology with vicilin: Partial characterization and antifungal activity. Sci. Hortic.111, 399–405. doi: 10.1016/j.scienta.2006.11.004
83
RodriguesM. L. (2018). The multifunctional fungal ergosterol. mBio9, e01755–e01718. doi: 10.1128/mBio.01755-18
84
RoyA. (2016). Bhut Jolokia (Capsicum chinense Jaqc): a review. Science1118, 4.
85
RyanC. A.PearceG. (2003). Systemins: a functionally defined family of peptide signals that regulate defensive genes in Solanaceae species. Proc. Natl. Acad. Sci. U. S. A100 (Suppl. 2), 14577–14580. doi: 10.1073/pnas.1934788100
86
SalasC. E.Badillo-CoronaJ. A.Ramírez-SoteloG.Oliver-SalvadorC. (2015). Biologically active and antimicrobial peptides from plants. Bio. Res. Int.2015, 102129–102129. doi: 10.1155/2015/102129
87
SaniM. A.SeparovicF. (2016). How membrane- active peptides get into lipid membranes. Acc. Chem. Res.49, 1130–1138. doi: 10.1021/acs.accounts.6b00074
88
SarnthimaR.KhammuangS. (2012). Antibacterial activities of Solanum stramonifolium seed extract. Int. J. Agric. Biol.14, 111–115.
89
SchmidtN. W.WongG. C. L. (2013). Antimicrobial peptides and induced membrane curvature: geometry, coordination chemistry, and molecular engineering. Curr. Opin. Sol. Stat. Mat. Sci.17, 151–163. doi: 10.1016/j.cossms.2013.09.004
90
SeguraA.MorenoM.MaduenoF.MolinaA.Garcia-OlmedoF. (1999). Snakin-1, a peptide from potato that is active against plant pathogens. Mol. Plant Microbe Interact.12 (1), 16–23. doi: 10.1094/MPMI.1999.12.1.16
91
ShahV. V.ShahN. D.PatrekarP. V. (2013). Medicinal Plants from Solanaceae Family. Res. Pharm. Technol.6, 143–151.
92
SilvaP.GonçalvesS.SantosN. (2014). Defensins: antifungal lessons from eukaryotes. Front. Microbiol.5, 1–17. doi: 10.3389/fmicb.2014.00097
93
SilvaM. S.RibeiroS. F.TaveiraG. B.RodriguesR.FernandesK. V.CarvalhoA. O.et al. (2017). Application and bioactive properties of CaTI, a trypsin inhibitor from Capsicum annuum seeds: membrane permeabilization, oxidative stress and intracellular target in phytopathogenic fungi cells. J. Sci. Food Agric.97, 3790–3801. doi: 10.1002/jsfa.8243
94
SimpsonB. B.Conner-OgorzalyM. (1986). Economic botany (New York: McGraw-Hill New York etc).
95
SinghR.SureshC. (2016). Purification and Characterization of a Small Chito-specific Lectin from Datura innoxia Seeds Possessing Anti-microbial Properties. Int. J. Biochem. Res. Rev.9 (2), 1–17. doi: 10.9734/IJBCRR/2016/22157
96
SoniP.SiddiquiA. A.DwivediJ.SoniV. (2012). Pharmacological properties of Datura stramonium L. as a potential medicinal tree: an overview. Asian Paci. J. Trop. Biomed.2, 1002–1008. doi: 10.1016/S2221-1691(13)60014-3
97
StotzH. U.SpenceB.WangY. (2009). A defensin from tomato with dual function in defense and development. Plant Mol. Biol.71, 131–143. doi: 10.1007/s11103-009-9512-z
98
TamokouJ. D. D.MbavengA. T.KueteV. (2017). “Chapter 8 - Antimicrobial Activities of African Medicinal Spices and Vegetables,” in Medicinal Spices and Vegetables from Africa. Ed. Kuete.V. (San Diego, California: Academic Press), 207–237.
99
TaveiraG. B.MathiasL. S.Da MottaO. V.MachadoO. L.RodriguesR.CarvalhoA. O.et al. (2014). Thionin-like peptides from Capsicum annuum fruits with high activity against human pathogenic bacteria and yeasts. Pept. Sci.102, 30–39. doi: 10.1002/bip.22351
100
TaveiraG. B.CarvalhoA. O.RodriguesR.TrindadeF. G.Da CunhaM.GomesV. M. (2016). Thionin-like peptide from Capsicum annuum fruits: mechanism of action and synergism with fluconazole against Candida species. BMC Microbiol.16, 12. doi: 10.1186/s12866-016-0626-6
101
TheisT.WeddeM.MeyerV.StahlU. (2003). The antifungal protein from Aspergillus giganteus causes membrane permeabilization. Antimicrob. Agents Chemother.47, 588–593. doi: 10.1128/AAC.47.2.588-593.2003
102
TripathiG. R.ParkJ.ParkY.HwangI.ParkY.HahmK.-S.et al. (2006). Potide-G derived from potato (Solanum tuberosum L.) is active against potato virus YO (PVYO) infection. J. Agric. Food Chem.54, 8437–8443. doi: 10.1021/jf061794p
103
WestermannJ.-C.CraikD. J. (2010). “5.09 - Plant Peptide Toxins from Nonmarine Environments,” in Comprehensive Natural Products II. Eds. LiuH.-W.Mander.L. (Oxford: Elsevier), 257–285.
104
YadavR.RathiM.PednekarA.RewachandaniY. (2016). A Detailed Review on Solanaceae Family. Eur. J. Pharma. Med. Res.3, 369–378.
Summary
Keywords
antimicrobial peptides, Solanaceae, ethnobotany, antibiotic resistance, traditional medicine
Citation
Afroz M, Akter S, Ahmed A, Rouf R, Shilpi JA, Tiralongo E, Sarker SD, Göransson U and Uddin SJ (2020) Ethnobotany and Antimicrobial Peptides From Plants of the Solanaceae Family: An Update and Future Prospects. Front. Pharmacol. 11:565. doi: 10.3389/fphar.2020.00565
Received
15 November 2019
Accepted
14 April 2020
Published
07 May 2020
Volume
11 - 2020
Edited by
Christian W. Gruber, Medical University of Vienna, Austria
Reviewed by
Octavio Luiz Franco, Catholic University of Brasilia (UCB), Brazil; Johannes Koehbach, University of Queensland, Australia
Updates
Copyright
© 2020 Afroz, Akter, Ahmed, Rouf, Shilpi, Tiralongo, Sarker, Göransson and Uddin.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Shaikh Jamal Uddin, uddinsj@yahoo.com
This article was submitted to Ethnopharmacology, a section of the journal Frontiers in Pharmacology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.