ORIGINAL RESEARCH article

Front. Microbiol., 24 September 2019

Sec. Antimicrobials, Resistance and Chemotherapy

Volume 10 - 2019 | https://doi.org/10.3389/fmicb.2019.02154

Design and Expression of Specific Hybrid Lantibiotics Active Against Pathogenic Clostridium spp.

  • Department of Molecular Genetics, Groningen Biomolecular Sciences and Biotechnology Institute, Faculty of Science and Engineering, University of Groningen, Groningen, Netherlands

Abstract

Clostridium difficile has been reported as the most common cause of nosocomial diarrhea (antibiotic-associated diarrhea), resulting in significant morbidity and mortality in hospitalized patients. The resistance of the clostridial spores to antibiotics and their side effects on the gut microbiota are two factors related to the emergence of infection and its relapses. Lantibiotics provide an innovative alternative for cell growth inhibition due to their dual mechanism of action (membrane pore-forming and cell wall synthesis inhibition) and low resistance rate. Based on the fact that bacteriocins are usually active against bacteria closely related to the producer strains, a new dual approach combining genome mining and synthetic biology was performed, by designing new lantibiotics with high activity and specificity toward Clostridium. We first attempted the heterologous expression of putative lantibiotics identified following Clostridium genome mining. Subsequently, we designed new hybrid lantibiotics combining the start or end of the putative clostridial peptides and the start or end parts of nisin. The designed peptides were cloned and expressed using the nisin biosynthetic machinery in Lactococcus lactis. From the 20 initial peptides, only 1 fulfilled the requirements established in this work to be considered as a good candidate: high heterologous production level and high specificity/activity against clostridial species. The high specificity and activity observed for the peptide AMV10 makes it an interesting candidate as an alternative to traditional antibiotics in the treatment of C. difficile infections, avoiding side effects and protecting the normal gut microbiota.

Introduction

The genus Clostridium comprises about 150 metabolically diverse species of Gram-positive, endospore-forming anaerobic bacteria that are ubiquitous in virtually all anoxic habitats where organic compounds are present, including soils, aquatic sediments, and the intestinal tracts of animals and humans (Udaondo et al., 2017). Although almost all Clostridium spp. are commensal strains, some species of clostridia (e.g., C. perfringens, C. botulinum, C. tetani, or C. difficile) are known to be opportunistic, toxin-producing pathogens in both animals and humans (Cassir et al., 2016; Kiu and Hall, 2018; Czepiel et al., 2019). Between the pathogenic clostridia, C. difficile is gaining increased attention from the research community because of its ability to escape the biocidal action of antibiotics and because of the growing number of infections especially in hospitals, where C. difficile is one of the most common acquired infections (Czepiel et al., 2019). In fact, C. difficile has been recognized as the most frequent pathogen in nosocomial diseases in Europe, causing diarrhea or pseudomembranous colitis. It has always been related to the elderly until the start of the new millennium, when numerous studies have described several outbreaks in Europe (Bauer et al., 2011), with more than 150,000 cases per year of C. difficile infection and a 20-fold increase of mortality. Those events have been attributed to the emergence of new and more virulent strains (Mastrantonio and Rupnik, 2018). The guidelines for treatment against C. difficile infections include non-antimicrobial therapies such as fecal microbiota transplantation (FMT). There has been evidence of the effectiveness of FMT (Ramai et al., 2019). In fact, in most cases, this is sufficient for full resolution of the disease (∼25% of patients) (Collins and Auchtung, 2017). Although FMT is recommended for C. difficile treatment, some adverse effects as nausea, abdominal pain, and FMT−related diarrhea have been observed in about 20% of the cases, and more severe adverse effects happen in about the 3% of the cases (Wang et al., 2016; Cheng et al., 2019). In terms of antimicrobial treatments, some antibiotics such as vancomycin and metronidazole are used. Nevertheless, these antibiotics do not affect spores, and for this reason, the treatments have to be administered for a prolonged time. Antibiotics also lead to the disruption of the gut microbiota because of their low specificity, allowing the pathogen to proliferate and colonize the human gut after the treatment (Mathias et al., 2019). Moreover, the misuse of antibiotics has a central role in the emergence of novel and more virulent strains, characterized by higher antibiotic resistance and toxin production (Yakob et al., 2015; Candel-Pérez et al., 2019; Fatima and Aziz, 2019). Several different strains have been reported to show a decrease in susceptibility or to be resistant to more than one antibiotic (Peng et al., 2017). Factors and mechanisms responsible for resistance include chromosomal genes, mobile genetic elements, biofilm formation and modification of antibiotic targets or metabolic pathways, among others. As a result, the development of novel specific antimicrobial compounds against Clostridium spp. turn out to be a necessity and a very relevant line of investigation.

Recent studies showed the potential of lantibiotics as an alternative to conventional antibiotics (van Heel et al., 2011; Hudson and Mitchell, 2018; Lewies et al., 2018). The term lantibiotic refers to lanthionine containing peptides with antimicrobial activity. They are ribosomally synthesized peptides produced mainly by Gram-positive bacteria and characterized by the presence of the atypical amino acid as dehydrobutyrine and dehydroalanine (formed after dehydration of threonine and serine residues respectively). These amino acids can react with the SH group of a cysteine forming a thioether-linked amino acid called lanthionine or a methyl-lanthionine ring, increasing the stability of the peptides (de Vos et al., 1995; van Kraaij et al., 1999; Alvarez-Sieiro et al., 2016; Repka et al., 2017). Lantibiotics are also characterized by their low resistance level of their targets. This is because most of them have multiple modes of actions: pore-forming on the cell walls causing ATP leakage or the sequestration of cell wall precursor lipid II, that inhibits the cell wall synthesis and the replication (Sahl et al., 1995; Breukink and de Kruijff, 2006; Hasper et al., 2006).

The combination of genome mining and synthetic biology approaches can be used for the identification of novel lantibiotics and then employ the modularity and the orthogonality of engineering into the design of novel powerful antimicrobial peptides (van Heel et al., 2016; Montalbán-López et al., 2017; Schmitt et al., 2019). In silico analysis of putative lantibiotic genes using bioinformatic tools as BAGEL4 or Anti-Smash (Weber et al., 2015; van Heel et al., 2018) provides an accurate prediction of putative novel lantibiotics. BAGEL4 software can analyze DNA sequences by two different approaches. First, an indirect approach which is the context of bacteriocin- or RiPP gene-based mining and then a direct approach, which is structural gene-based mining directly via Glimmer software for finding genes in microbes (van Heel et al., 2018, 4). These approaches improve the success rate by reducing the false positive probability and minimize manual evaluation of results. Also, anti-SMASH is an application that predicts putative bacteriocin genes as well as their biochemical properties, and further details including gene cluster description, annotation, and genomic loci for the biosynthetic pathway (Weber et al., 2015). Combination of BAGEL4 and anti-SMASH for genome mining gives accurate information for identification of unknown lantibiotic genes in various organisms. Afterward, the new DNA sequence encoding the putative lanthipeptide gene can be fused to the nisin leader sequence and expressed heterologously in Lactococcus lactis (Montalbán-López et al., 2017). Alternatively, the design of hybrid lantibiotics by a combination of known ones, with enhanced antimicrobial activity has also been described as a potent tool for the identification of new drugs (Schmitt et al., 2019).

With some exceptions, bacteriocin/lantibiotics are usually active against strains closely related to the producer one (Yang et al., 2014; Todorov et al., 2019). The use of new peptides with high specific activity against Clostridium spp. and with low or no activity against other bacteria would provide a good strategy in the treatment of C. difficile infections, minimizing or limiting one of the most unwanted side effects of traditional antibiotics after prolonged treatments, i.e., gut microbiota modification. This alteration is related to the recurrence of the infection and also to other pathologies such as diarrhea (Nelson, 2007; Song et al., 2008).

This study is focused on the identification, design, and production of new lantibiotics with enhanced activity against C. difficile. These new peptides must fulfill three requirements: high heterologous production using the nisin biosynthetic machinery, and high specificity and activity toward C. difficile.

Materials and Methods

Microorganisms, Plasmids, and Growth Conditions

The strains used in this work and the plasmid designs are listed in Table 1. Escherichia coli strains were grown in LB medium at 37°C and shaking. Lactococcus and Lactobacillus strains were grown in M17 + 0.5% of glucose (GM17) at 30°C without shaking. Bacillus, Enterococcus, Listeria, Staphylococcus, and Streptococcus strains were grown as described above but at 37°C. Clostridium strains were grown in Reinforced Clostridium Medium (RCM) at 37°C in anaerobiosis in a Coy Anaerobic Chamber. For solid media, agar at 1.2% was added. For AmpR resistant plasmids selection in E. coli, 100 μg/mL of ampicillin were added, while 5 or 10 μg/mL of chloramphenicol/erythromycin were added for L. lactis selection.

TABLE 1

StrainCharacteristic/purposeReferences
Escherichia coli TOP-10mcrA, Δ(mrr-hsdRMS-mcrBC), Phi80lacZ(del)M15, ΔlacX74, deoR, recA1, araD139, Δ(ara-leu)7697, galU, galK, rpsL(SmR), endA1, nupGThermo Fisher Scientific
pUC57-ClosxAmpR, synthetic gene designThis work
pUC57-AMVxAmpR, synthetic gene designThis work
Lactococcus lactis NZ9000pepN:nisRKde Ruyter et al., 1996
pIL253 pNZe-NisP8HEryR, CmR, NisP producer strainMontalbán-López et al., 2018
pTLR-BTCEryR, pepN:nisRK, nisBTC genes cloned from pIL3-BTC into pTLR plasmidLab collection
pTLR-BTC pNZ8048EryR, CmR, pepN:nisRK, nisBTCThis work
pIL3-BTC pNZ8048-NisAEryR, CmR, NisA producer strainvan Heel et al., 2013
pTLR-BTC pNZ8048-Clos2EryR, CmR, synthetic gene clos2 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-Clos4EryR, CmR, synthetic gene clos4 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-Clos5EryR, CmR, synthetic gene clos5 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-Clos12EryR, CmR, synthetic gene clos12 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-Clos14EryR, CmR, synthetic gene clos14 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-Clos15EryR, CmR, synthetic gene clos15 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-Clos16EryR, CmR, synthetic gene clos16 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-Clos17EryR, CmR, synthetic gene clos17 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-Clos22EryR, CmR, synthetic gene clos22 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-Clos24EryR, CmR, synthetic gene clos24 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-AMV1EryR, CmR, synthetic gene AMV1 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-AMV2EryR, CmR, synthetic gene AMV2 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-AMV3EryR, CmR, synthetic gene AMV3 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-AMV4EryR, CmR, synthetic gene AMV4 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-AMV5EryR, CmR, synthetic gene AMV5 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-AMV6EryR, CmR, synthetic gene AMV6 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-AMV7EryR, CmR, synthetic gene AMV7 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-AMV8EryR, CmR, synthetic gene AMV8 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-AMV9EryR, CmR, synthetic gene AMV9 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
pTLR-BTC pNZ8048-AMV10EryR, CmR, synthetic gene AMV10 cloned fused to nisin leader under Pnis promoter in pNZ8048-NisAThis work
Clostridium beijerinckii NIZO B504Indicator strainLab collection
C. botulinum CECT551Indicator strainCECT
C. difficile CECT531Indicator strainCECT
C. ihumii AP5Indicator strainMerhej et al., 2015
C. sporogenes C22/10Indicator strainAktypis et al., 1998
C. tyrobutyricum NIZO B574Indicator strainLab collection
Bacillus cereus ATCC10987Indicator strainATCC
Enterococcus faecalis LMG8222Indicator strainLMG
E. faecium LMG16003Indicator strainLMG
Listeria monocytogenes LMG10470Indicator strainLMG
Lactobacillus plantarum WCFS1Indicator strainKleerebezem et al., 2003
Lactococcus lactis MG1363Indicator strainWegmann et al., 2007
Staphylococcus aureus LMG8224Indicator strainLMG
Streptococcus salivarius HSISS3Indicator strainVan den Bogert et al., 2013

Strains and plasmids used in this work.

ATCC, American Type Culture Collection; CECT, Spanish Type Culture Collection; LMG, Belgian Co-ordinated Collections of Microorganism.

Genome Mining of Various Clostridium Strains and Synthetic Gene Design

Identification of novel putative lantibiotic genes was performed using BAGEL4 (van Heel et al., 2018) and antiSMASH (Weber et al., 2015). 563 genomes from Clostridium spp. strains and 43 of the recently separated Paeniclostridium sordelii genus (Sasi Jyothsna et al., 2016) deposited on the NCBI database were mined. Novelty, completeness of the gene cluster and the presence of lantibiotics-related protein domains, as the NisC interaction domain FxLx in the putative leader (van der Meer et al., 1994; Abts et al., 2013; Plat et al., 2013), were considered in the selection of the putative lantibiotic genes. Twenty synthetic genes (GeneScript) were designed by optimizing the codon usage to L. lactis using the Jcat program (Grote et al., 2005). The first 10, with the selected-putative-lantibiotic genes identified after genome mining (pUC-Closx) and the second 10 by the combination of the first or last rings of the putative lantibiotics with the first or last rings of nisin (pUC57-AMVx). To simplify the cloning, the genes were designed with 5′ and 3′ tags: TCGAGTTCAAAAAAAGATTCAGGTGCTAGC-gene-TAACTTTGAACCAAAATTAGAAAACCC in the case of the Closx genes and AMVx hybrids with the last part of nisin, and ATTACAAGTATAAGCTTATGTACACCCGGGTGT-gene-TAACTTTGAACCAAAATTAGAAAACCC in the case of AMVx hybrids with the first part of nisin. The plasmids with the designed genes were transformed into chemo-competent cells of E. coli TOP-10 (Green and Rogers, 2013) and then cloned into L. lactis.

Molecular Cloning

The designed plasmids pUC57-Closx were isolated, and each gene was amplified with specific primers designed for USER ligation (Geu-Flores et al., 2007), Clos-USER-fw and Pep-USER-rv, and cloned into pNZ8048-NisA (van Heel et al., 2013) fused to nisin leader (instead nisin) and under Pnis control. The backbone of pNZ8048-NisA was amplified using the primers Leader-USER-rv and pNZ-USER-fw. The same amounts of fragment and backbone were mixed and ligated using USER (NEB) enzyme according to the suppliers. After that, the ligation was dialyzed against ultra-pure water and transformed into electrocompetent cells of L. lactis NZ9000 pTLR-BTC (Holo and Nes, 1995), where the nisin processing enzymes (nisBC) and the transporter (nisT) were present. In the case of the other synthetic genes (pUC57-AMVx), the same procedure was performed with some differences regarding the primers used. For the hybrid peptides with the first part of nisin fused to the last part of the putative lantibiotics, the genes were amplified using Pep-USER-fw and Pep-USER-rv primers, while the primers Rab-USER-rv and pNZ-USER-fw were used for the backbone. For those hybrid peptides in which the last rings of nisin were fused to the first rings of the putative lantibiotics, Clos-USER-fw and Pep-USER-rv were used for the amplification of the genes, while pNZery-USER-fw and Leader-USER-rv were used for the backbone. The primer sequences and the PCR conditions are listed in Table 2. Finally, the different plasmids pNZ-Closx or pNZ-AMVx were isolated, and the correct sequences of the peptides were confirmed by sequencing (Macrogen Europe, Amsterdam, Netherlands).

TABLE 2

NameSequencePCR conditions
Pep-USER-fwAGTATAAGCTUATGTACA CCCGGGTGT1× 95°C 3 min, 30× (95°C 30 s, 55°C 30 s, 68°C 30 s), 1× 68°C 3 min
Pep-USER-rvACCGCATGCTUCTCGAGGGTTT TCTAATTTTGGTTCAAAG
Clos-USER-fwATCTTGTTTCAGUTTCAAAAAAA GATTCAGGTGCTAGCCCACGT

pNZ-USER-fwAAGCATGCGGUCTTTGAACCA AAATTAGAAAACCAAGGCTTG1× 95°C 3 min, 30× (95°C 30 s, 55°C 30 s, 68°C 5 min), 1× 68°C 6 min
Leader-USER-rvACTGAAACAAGAUCAAGATT AAAATCTTTTGTTGAC
Rab-USER-rvAAGCTTATACUTGTAATGCGT GGTGATGCACCTGAATC

pNZ-Cm-fwCATGCAGGATTGTTTATGAA CTCTATTCAGGAATTGTCAG1× 95°C 3 min, 30× (95°C 30 s, 55°C 30 s, 68°C 1 min), 1× 68°C 3 min
pNZ-SphI-rvTCGCCGCATGCTATCAA TCAAAGCAACACGTGC

Primers and PCR conditions used in this work.

In italic and underlined the uracil nucleotide required for USER ligation.

Peptide Expression, Purification, Quantification, and Characterization

Initially, TCA precipitation (Sambrook et al., 1990) was performed in order to identify the peptides with better expression. Briefly, 50 mL of minimal expression medium (MEM) (Rink et al., 2005) was inoculated at 2% from an overnight culture of the producer strains grown in GM17 with the corresponding antibiotics. The cells were incubated at 30°C until the OD600nm reached 0.4–0.6, and at this point, nisin at 10 ng/mL was added to induce the expression. The culture was left in the same conditions overnight. The cells were removed and TCA at 10% (final concentration) was added to the supernatants, that were placed on ice for 2 h. Finally, the peptides were collected by centrifuging at 10,000 rpm for 1 h at 4°C, washed with cold acetone and resuspended in 0.5 mL of 0.05% acetic acid. The peptides were analyzed by Matrix-Assisted Laser Desorption/Ionization with a Time-Of-Flight detector (MALDI-ToF) and those peptides detected were selected for a large-scale purification using 1 L of MEM medium.

After the induction and incubation, the peptides were purified as described by Cebrián et al. (2012). Briefly, the culture pH was raised to 6 and mixed with Sephadex CM-25 (Sigma–Aldrich) (previously swollen overnight in distilled water at 4°C) at 1:10 (vol:vol). The mixture was shaken for 1 h, and then the CM-25 was decanted and placed into a chromatographic column. The CM-25 was washed with 1 L of distilled water, and the peptides were eluted with 800 mL NaCl 2 M distributed in 50 mL fractions. The active fractions were applied on reverse-phase C18 chromatography for a second purification step. Isopropanol:acetonitrile (2:1) 0.1% trifluoroacetic acid (TFA) was used as organic phase (solvent B) while 0.1% of TFA in distillated water was used as aqueous phase (solvent A). The peptides were eluted from the C18 column with 10 mL of different percentages of solvent B (10, 20, 30, 40, 50, 60, and 80%). Finally, the fractions were lyophilized, and the peptides resuspended in 1 mL of solvent A.

To obtain highly pure peptides, the previous active fractions were purified by reverse-phase C4 HPLC. For the purification, the Jupiter 5 μ C4 300A column (Phenomenex) was equilibrated in 5% of solvent B, and then a linear gradient 5–60% of solvent B was applied to elute the peptides. The L. lactis NZ9000 pIL253 pNZe-NisP8H strain was used as a sensitive strain in the different purification steps.

Active fractions were lyophilized, resuspended in solvent A, and quantified using a QuantusTM fluorometer (Promega) and the QubitTM Protein Assay Kit (Thermo Scientific) according to the suppliers. Briefly, the samples were diluted 100-fold in 1× NanoOrange reagent working solution (1× NanoOrange protein quantitation diluent + 500-fold diluted NanoOrange protein quantification reagent), and the samples were incubated in the dark for 10 min at 93°C and then at room temperature for 20 min. After that, the fluorescence of the samples was measured in the QuantusTM fluorometer (Promega). Nisin at known concertation was used as a reference.

For the nisin leader cleavage, NisP was purified from the supernatant of 1 L of L. lactis NZ9000 pIL253 pNZe-NisP8H [a soluble NisP producer strain (Montalbán-López et al., 2018)] in MEM medium after a nisin induction (10 ng/mL) using a HistrapTM excel column (GE Healthcare) according to the suppliers. NisP was eluted with 20 mL of elution buffer (50 mM of NaH2PO4, 0.5 M NaCl, 200 mM imidazole, 20% of glycerol, pH 8) aliquoted and stored at −80°C. The ratio prenisin:NisP was optimized in 1:0.005 (prenisin 10% TCA precipitated supernatant:purified NisP) after 1 h at 37°C. The leader cleavage efficiency of the peptides was analyzed. For this, the purified peptides were mixed with NisP in the previous conditions, and the leader cleavage monitored each 1 h during 3 h using MALDI-ToF.

Finally, the dehydration level of the peptides was determined after the cleavage by MALDI-ToF according to the methodology described by van Heel et al. (2013). The average expected masses were calculated using the ProtParm program (Wilkins et al., 1999) and the percentage of each dehydration peak was calculated approximately as an average of the intensity of each peak after several MALDI-ToF analyses. The best peptides were analyzed for the ring formation using N-ethylmaleimide (NEM) reaction according to Yang and van der Donk (2015) methodology.

Antimicrobial Test

Minimal inhibitory concentration (MIC) measurements using a 96-well plate microdilution method and spot overlay assays were performed as systems for antimicrobial testing. Clinical and Laboratory Standards Institute (CLSI) indications were followed as far as possible. Mueller Hinton Agar (Difco, Thermo scientific) was used in the spot overlay screening test for the indicator strains (Hockett and Baltrus, 2017). In this case, NisP and the peptides were mixed as above and spotted (5 μl) on the indicator strains. For the MIC test, NisP was added into the liquid medium (RCM) in a relation 1:0.005 and then, serial dilutions of the peptides (from 32 to 0.003 μg/mL) were performed by triplicate. Finally, the indicator strains were added at 105 CFU/mL. All assays with Clostridium were performed in a Coy Anaerobic Chamber.

Results

Lantibiotics Genome Mining of Clostridium spp.

In general, Clostridium spp. are organisms relatively difficult to grow, and require complex media as well as anaerobiosis. The identification of antimicrobial peptides in this genus is usually hard, and their production at high levels is challenging. In order to identify new lantibiotics specific and active against pathogenic Clostridium strains as C. difficile, two bioinformatics programs were used. Firstly, high-throughput screening of genomic data was accomplished using AntiSMASH (Weber et al., 2015) and then small putative lantibiotic ORFs were identified using BAGEL4 (van Heel et al., 2018). 563 genomes belonging to 110 Clostridium species, as well as 43 strains of P. sordelii that had been entirely sequenced and stored in Genebank NCBI, were mined.

All genomes were uploaded on the AntiSMASH program for the first selection of possible lantibiotic sequences identification. From the 606 initial genomes, only 17 were identified harboring putative lantibiotics sequences. They were downloaded and analyzed with BAGEL4. Finally, 54 putative lantibiotic genes were detected (Supplementary Table S1). Among all putative lantibiotic detected, 10 genes were selected for heterologous expression in L. lactis NZ9000 pTLR-BTC.

Putative Lantibiotics Selection, Expression, and Characterization From Clostridium spp.

Lantibiotics Selection

Based on novelty, the presence of all modification enzymes in the cluster (Figure 1) and the presence of some lantibiotic-related domains, 10 putative lantibiotic genes (Table 3) were selected, synthesized, and cloned, fused to the nisin leader under the Pnis promoter in pNZ-8048. The designed plasmids were transformed into L. lactis NZ9000 cells pTLR-BTC, which provides the rest of the genes necessary for their biosynthesis. Leader sequences were assigned manually considering the known leader cutting site for other lantibiotics (presence of P in the cleavage area, GG motifs, similar cutting site to known lantibiotics), the distance from the FxLx box (Abts et al., 2013), or the position of the first C (Table 3). In order to ensure the novelty of the selected peptides, a BLASTp analysis was performed for each one.

FIGURE 1

TABLE 3

NameStrainPutative leaderPutative core peptideS + T
Clos2C. beijerinckii HUN142VGKLDDFDLDVKVKINSKKGIKPSYLSLTPKCTSLCPTNVFVCISKRCK6
Clos4MGKLDDFDLDVKVKATPKGGVKPSITSRILCTSSCYTQFIQCHDRV6
Clos5MGKLDNFDLDVKIKKDEKRGVKPSVTSYSACTPGCATSLFRTCLTRSCKGC9
Clos12C. ihumii AP5MPNYKEFDLDIRNEKNNLKSMNSKKRSDGGTCYYSCGCKTNEGNSCGKVCFTDTIVCGTDFDGR7
Clos14MPNYKDFDLDIQNIKMNKINDKRRYPISDKRDDMSMCVCKKTDVCKTHETDSCNNGLCFESGKCTWV8
Clos15MPNYKDFDLDIQNSKLGVDSSRKVLPPTFSYEYDKLSECRCRPKTQTCATHCSCATYCNGSCNQHTDCAL10
Clos16MPNYKEFDLDIRNSKNGINMYGPSAVIVPATDGGGKKTVCGRTCNGSACNPNSCQTRCIKPAD6
Clos17MPNYKDFDLDIQNNKSSVNSIKTTTMPPTFSYEYDQYSECVCKPKTRNSCVTYCNGSCNQHTDCTL9
Clos22C. perfringens D JGS1721MMKQLDKKSKTGIYVQVASDKELELLVGGAGAGFIKTLTKDCPEVVSQVCGSFFGWVSACKNC5
Clos24Clostridium sp. BR31MDDFDLDLRKIAENGNSANALSASDMITSEIISKVTETITRTFKGQCVSVETPTTGMTSACCKKGGTDVEPQCVP11

Putative lantibiotic sequences selected for L. lactis heterologous expression.

In bold, domain related to the peptide processing. S and T positions are indicated in green while C positions are in red.

In the case of the putative lantibiotics from C. beijerinckii HUN142 (Clos2, Clos4, and Clos5 in this study), the complete set of biosynthetic genes including putative modification enzymes, ABC transporters, regulation, immunity, and protease protein was identified in the cluster, which shows similarity to the class I lantibiotic biosynthetic genes cluster (Figure 1A). Interestingly, this cluster appears to be duplicated. One part could be related to Clos2 and Clos4 production and the other one with Clos5 production. Based on BLASTp homology (NCBI) analysis, these peptides belong to the gallidermin/nisin family, but low level of homology and/or similarity was observed except for Clos5. In this case, the putative lipid II binding domain region (CTPGCA) is the same as for gallidermin or nisin. Another putative antimicrobial peptide corresponding to streptin but with two modifications (G2N and M6A) was also identified in this cluster.

Clostridium ihumii AP5 is a new species of Clostridium isolated from a French Caucasian female with anorexia nervosa (Merhej et al., 2015). Surprisingly, 11 putative lantibiotic genes were identified after the mining in this strain and only one lanBTC putative system (Figure 1B). In their sequences, they are quite diverse, limiting the similarities to the first 15 aa of the leader peptide (Supplementary Table S1). After a BLASTp analysis of these peptides, no homologies were found, and no other lantibiotic has been described with similar characteristics. For this reason, 5 of them (Clos12, Clos14, Clos15, Clos16, and Clos17) were selected for their heterologous expression.

One single component lantibiotic from Class II lanthipeptides was found in C. perfringens D JGS1721 coded (Figure 1C) as Clos22 and identified as type A(II) lantibiotic which is known to have two domains, a linear N-terminal region and a globular C-terminal region. These types of lantibiotics show a slightly different mode of action than the type A(I) lantibiotics since they only can inhibit cell wall synthesis by the interaction with the lipid II (no pore-forming activity). After a BLASTp analysis, a 52% of identity with the predicted lantibiotic columbicin A was observed.

Taken from the newest study about Clostridium sp. BR31, this species was previously known as novel species in the genus of Clostridium as was still listed in Clostridium genome databases when this study started, but recently it had a new order in taxonomy and was declared as a new genus in Clostridium cluster XIVa, in the family Lachnospiraceae. This species now is designated as Merdimonas faecis gen. nov., sp. nov (Seo et al., 2017). An a-typical cluster structure was observed for this strain, with two lanC genes separated by lanT and lanB, as well as the presence of the lanM gene upstream of the structural gen (Figure 1D). The unusual distribution of the cysteines in the peptide makes it difficult to place it inside the lantibiotics groups. No homologies were found with other lantibiotics after the BLASTp analysis.

Lantibiotics Expression and Characterization

As a first approximation, 10% TCA precipitation was performed, and the samples were analyzed by MALDI-ToF. Unfortunately, from the 10 peptides, only Clos2, Clos4, and Clos5 were observed. So, these strains were selected for a larger purification using 1 L of MEM medium, CM-25, C18, and RP-HPLC (Figure 2A).

FIGURE 2

The production levels obtained for the peptides in comparison with nisin were not high, being the lowest for Clos4. Many peaks were also observed indicating different levels of dehydration (hetero-dehydration) (Figure 2A). The peptides were analyzed by MALDI-ToF, and a strong hetero-dehydration, as well as degradation of the peptides, was observed, specifically in the case of Clos4 and Clos5. According to the observed masses, N-terminal degradation of the peptide leader (MSTKDFNLDLV and/or MSTKDFNLDLVSV degradation) could be related to this (Figure 3).

FIGURE 3

Finally, in order to establish the dehydration levels for each peptide and because of the high ratio of N-terminal degradation, the peptides were digested with NisP. Firstly, the efficiency of the cleavage was analyzed monitoring the leader release during 3 h. In the case of these peptides, almost all the peptides were cleaved after this time. However, the efficiency was much lower than for nisin during the first and second hour (Supplementary Figure S1). The percentage of each dehydration level was approximately calculated considering the intensity of each peak after MALDI-ToF (Figure 4 and Table 4) (the results were similar for different MALDI-ToF analyzed samples). In general, low dehydration levels were observed. In the case of Clos2, 11.4% of the observed peptide was non dehydrated, while 29.9% were with −3 H2O and only the 2.4% of the peptide was fully dehydrated (−6 H2O) (Table 4). In the case of Clos4, it was the best dehydrated, no full dehydrated peptides (−6 H2O) were observed, and 21, 35, and 26.5% of dehydration was observed for −5, −4, and −3 H2O, respectively (Table 3). A 5.8% of the peptide was no dehydrated. Finally, for Clos5, the 6.1% of the peptide was fully dehydrated (−9 H2O), but the higher dehydration range was −6 H2O (22.7%) (Table 4).

FIGURE 4

TABLE 4

DehyClos2Clos4Clos5AMV1AMV2AMV3AMV4







MW%MW%MW%MW%MW%MW%MW%
02805.411.42575.05.82817.32571.12485.92823.43021.5
12787.414.12557.08.32799.32553.12.672467.96.32805.43003.517.3
22769.416.72539.017.12781.37.32535.16.412449.99.02787.44.52985.517.0
32751.429.92521.026.62763.310.82517.111.632431.915.02769.48.12967.525.1
42733.417.42503.035.32745.311.32499.121.382413.933.72751.411.02949.527.9
52715.48.12485.020.92727.314.62481.130.872395.936.02733.417.02931.530.1
62697.42.42467.02709.322.72463.127.032715.427.92913.517.0
72691.317.42697.424.82895.5
82673.39.82679.414.0
92655.36.12661.45.3

DehyAMV5AMV6AMV7AMV8AMV9AMV10






MW%MW%MW%MW%MW%MW%

03186.83406.93732.53713.53808.518.83587.3
13168.84.23388.93714.53695.58.13790.511.53569.3
23150.811.23370.910.13696.53677.512.03772.511.93551.3
33132.819.53352.920.53678.511.83659.523.53754.517.13533.38.6
43114.819.93334.930.43660.520.13641.523.63736.518.63515.311.4
53096.824.53316.919.13642.522.83623.516.23718.512.83497.315.9
63078.820.63298.911.03624.521.83605.59.03700.59.23479.318.7
73060.83280.99.03606.511.13587.57.73682.53461.322.8
83588.56.93443.313.2
93570.55.43425.39.4
103407.3

Molecular weight for the different AMV peptides and abundance.

In the case of AMV6, the masses are corresponding to the peptide AMV6 without the C-terminal part ESGKCTWV.

Antimicrobial Activity Test

One milliliter fractions of the HPLC was collected between minutes 15 and 25. These fractions were lyophilized and stored. Because the state of dehydration is essential for the activity, and the activity of the peptides against different bacteria could be related to the state of dehydration, the four fractions corresponding to the main peaks of each lantibiotic were resuspended in 1 mL of solvent A and were assayed against Gram-positive bacteria using spot overlay test (5 μL drops). In Figure 3, the antimicrobial activity is represented. NisP was previously added into the plates for the leader cleavage. No activity was observed for the peptides Clos2, Clos4, and Clos5 against the tested bacteria, except for B. cereus ATCC10987 for which a small halo was observed for the fraction 4 of each peptide. Finally, the same test was performed against three strains of Clostridium (Figure 5), but unfortunately, no antimicrobial activity was observed.

FIGURE 5

Chimeric Peptide Design, Expression, and Characterization

Since the specificity toward Clostridium could be related to the lipid II binding domain or with the other rings, and because of the relatively high activity of nisin against Clostridium, we decided to design new lantibiotics by a synthetic biology approach combining different parts of the putative lantibiotics and nisin.

Peptide Design

Ten different peptides were designed (Table 5 and Figure 6). Five peptides were designed based on the peptides Clos2, Clos4, and Clos5 and the other five based on the other lantibiotics identified after the mining. Originality and new lantibiotic structure design were also considered. Depending on the nisin part used in the fusion, three kinds of peptides were designed. The first group contains those peptides for which the first two rings of nisin were fused to the last part of the putative lantibiotics. AMV1 was designed in this line by the fusion of nisin AB rings and the putative last two rings of Clos2, AMV2 with the putative last ring of Clos4 and AMV3 with the putative last three rings of Clos5. The idea, in this case, was to design the new peptides with the structure close to the wild putative lantibiotic peptide (Figure 6).

TABLE 5

PeptidesSequenceS + T
NisinITSISLCTPGCKTGALMGCNMKTATCHCSIHVSK9
AMV1ITSISLCTPGCPTNVFVCISKRCK7
AMV2ITSISLCTPGCYTQFIQCHDRV5
AMV3ITSISLCTPGCATSLFRTCLTRSCKGC9
AMV4ITSISLCTPGCKTGALMGCTIVCGTDFDGR7
AMV5ITSISLCTPGCKTGALMGCSFFGWVSACKNC7
AMV6ITSISLCTPGCKTGALMGCKTHETDSCNNGLCFESGKCTWV10
AMV7YLSLTPKCTSLCKTGALMGCNMKTATCHCSIHVSK9
AMV8ISDKRDDMSMCVCKKTDVCNMKTATCHCSIHVSK7
AMV9AGAGFIKTLTKDCPEVVSQVCNMKTATCHCSIHVSK7
AMV10ITSRILCTSSCKTGALMGCNMKTATCHCSIHVSK10

Sequence of the nisin hybrid designed peptides.

In shading the nisin part of the peptides. S and T positions are indicated in green while C positions are in red.

FIGURE 6

Another group of chimeric peptides consisted of those for which the first three rings of nisin and the last part of the putative lantibiotics were combined. AMV4 was designed by the fusion of the nisin ABC rings and the last putative ring of Clos12, obtaining a peptide with four putative rings and a long C terminal tail. AMV5, obtained by the fusion with the last putative two rings of Clos22, obtaining a peptide with five putative rings (as nisin) and with a putative end ring (as described for many other lantibiotics). AMV6 was obtained by the fusion with the last three putative rings of Clos14, obtaining a long lantibiotic with six putative rings and a tail (Table 5 and Figure 6).

Finally, another group was containing peptides with the first part of Clostridium peptide and the last part from nisin. AMV7 and AMV10, with the first two rings of Clos2 and Clos4, respectively, and the last three rings of nisin, obtaining peptides with five putative rings closely to nisin. The peptides AMV8 and AMV9 were designed with the first putative two rings of Clos14 and Clos22, respectively, and the last two rings of nisin (with the hinge region included) (Table 5 and Figure 6).

AMVx Cloning, Expression, and Characterization

As before, each peptide was independently cloned fused to the nisin leader and under control of the Pnis promoter in pNZ8048 and transformed into L. lactis NZ9000 pTLR-BTC strains. TCA precipitation and MALDI-ToF analysis were also performed, finding the peptides in the supernatant in all the cases, so 1 L purification was performed using the methodology described for Closx peptides.

The best peptide production levels were obtained for AMV5, AMV7, and AMV10, and moderate levels of production were obtained for AMV1, AMV2, and AMV3 (Figures 2B–E). In the case of AMV4, AMV6, AMV8, and AMV9, the production levels were very low (especially for AMV9) (Figure 2). As before, many peaks were observed for each peptide, suggesting different dehydration levels. As before, after MALDI-ToF analysis different degradation levels for the peptides were observed, but interestingly the N-terminal leader degradation was stronger in the case of the peptides for which the first part of nisin was used (Figure 7). This fact was especially observed in the case of the peptides AMV1, AMV2, AMV3, AMV4, AMV5, and AMV6, and to a lesser extent for the peptides AMV7, AMV8, AMV9, and AMV10 (Figure 7). In some cases, the N-terminal degradation also affected the designed peptides as in AMV5, where peaks without the first I or without the first ring (ITSILC) were observed. Interestingly, this fragment was not fully dehydrated, suggesting that the ring protects from degradation. Another example is the peptide AMV9. In this case, the complete nisin leader was observed as well as the core peptide without the first four aa (AGAG). This piece could have been released spontaneously or by a specific protease, where this sequence could be targeted. In the case of the peptides, AMV2, AMV4, and AMV6, also a putative C-terminal degradation was detected, although the peptide with higher degradation rate was AMV4. HDRV C-Ter degradation was observed for AMV2, ESGKCTWV C-Ter degradation for AMV6, and until IVCGTDFDGR in the case of AMV4.

FIGURE 7

As before, and in order to establish the dehydration level for each peptide, they were digested with NisP. The leader cleavage efficiency was also checked for these peptides, and in general, after 3 h of incubation the leader was released entirely in all the peptides with the exception of AMV5 where the leader cleavage efficiency was a bit lower (Supplementary Figure S2). The percentage of dehydration was approximately calculated considering the intensity of each peak in the MADI-ToF (Figure 4 and Table 4). Only the peptides AMV1, AMV2, AMV3, AMV6, AMV7, and AMV8 were fully dehydrated, but in general, all were dehydrated to a greater or lesser extent (Table 4).

AMVx Antimicrobial Activity and Ring Formation

As in the case of the Closx firstly, the four HPLC fractions corresponding to the main peaks were assayed against different Gram-positive bacteria and Clostridium. In general, the peptides were not active against the Gram-positive bacteria assayed (Figure 5) with the exception of B. cereus. In this case, fraction 4 of the truncated peptide AMV6 displayed an evident antimicrobial activity, while others as AMV1 or 8 displayed a weak activity. Interestingly, the fractions 2, 3, and 4 of peptide AMV10 showed antimicrobial activity against Streptococcus salivarius but not against the rest of the tested bacteria (Figure 5).

In the case of Clostridium (Figure 5), two of the designed peptides showed an explicit activity: AMV5 and AMV10. The first one against C. ihumii and the other against the three Clostridium tested. Curiously, the fractions 1 and 2 of AMV10 were active against C. ihumii unlike in S. salivarius. A really weak activity was also observed for the fraction 2 of AMV1 and the fraction 4 of AMV6 against C. botulinum and C. difficile, respectively.

Based on these results, the peptides AMV5 and AMV10 were used for the antimicrobial test in liquid medium. The peptides were quantified using QubitTM Protein Assay Kit and a fluorimeter, and then, they were assayed by triplicate at concentration ranged from 32 to 0.007 μg/mL against six different strains of Clostridium. NisP was added to the culture medium to ensure the release of the leader.

According to Table 6, AMV10 displayed a broad and high antimicrobial activity against some pathogenic Clostridia, such as C. difficile or C. botulinum with MIC values between 0.25 and 2 μg/mL. The same activity was observed for C. ihumii. C. beijerinckii was resistant to the higher concentration used, and C. sporogenes was sensitive to 32 μg/mL. AMV5 was less active than AMV10 being the only sensitive bacteria C. ihumii and C. botulinum (16 μg/mL). Prenisin was used in the same conditions as a positive control. As expected, a strong activity was observed against C. difficile, C. botulinum, and C. ihumii. C. sporogenes was resistant.

TABLE 6

StrainsMIC (μg/mL)

AMV5AMV10Nisin
Clostridium beijerinckii NIZO B50432> 328
C. botulinum CECT5513221
C. difficile CECT531> 3220.03
C. ihumii AP53210.5
C. sporogenes C22/10> 3232>32
C. tyrobutyricum NIZO B574> 32> 324

MIC values determined by broth microdilution method against several clostridial strains.

Finally the ring formation was analyzed for AMV5 and AMV10 (Figure 8). In general, the ring was installed. In the case of AMV10, in some cases one of the five rings was not installed for peptides with −8, −7, or −6, but interestingly, for the −9H2O peptide all the ring were installed. In the case of AMV5 one ring or two rings were not installed in some cases, even in the more dehydrated peptide (−6H2O).

FIGURE 8

Discussion

The treatment of infections caused by pathogenic Clostridium spp. poses a significant challenge in medicine, in particular by the ability of these bacteria to form spores that escape from the biocidal action of traditional antibiotics. Usually, the treatment requires the administration of antibiotics for a long time, and the broad activity of these antibiotics is related to the alteration of the gut microbiota. The most common pathogen of antibiotic-associated diarrhea is C. difficile. It is a Gram-positive, endospore-forming bacterium that has been recognized as one of the most frequent pathogens in nosocomial diseases, being related with a high index of morbidity and mortality (Miller et al., 2016). C. difficile is responsible for diarrhea and/or pseudomembranous colitis, and it is the first cause of antibiotic-associated diarrhea which is the most common adverse event related to antibiotic use (Dicks et al., 2018; Mullish and Williams, 2018). After long antibiotic treatments, the normal microbiota is damaged, and the spores of C. difficile, that are in virtually all healthy human, can germinate fast, releasing toxins and producing the infection. The ability of C. difficile spores to escape the biocidal action of the antibiotics used for its treatment produces relapses in the disease and recurrence (Mathias et al., 2019; Song and Kim, 2019).

The aim of this work was the design of new antimicrobials with potent and specific antimicrobial activity against Clostridium strains and especially against C. difficile. Starting from the premise that bacteriocins are usually active against bacteria closely related to the producing strain (Zacharof and Lovitt, 2012; Yang et al., 2014; Ventura et al., 2015), and using gene mining approaches (Weber et al., 2015; van Heel et al., 2016, 2018, 4; Montalbán-López et al., 2017), we have identified 54 putative lantibiotic sequences after the analysis of more than 560 Clostridium spp. genomes deposited in NCBI. From these putative lantibiotics, 10 were selected for its heterologous expression in L. lactis using the nisin biosynthetic machinery (Montalbán-López et al., 2017).

Among the genomes analyzed, the one from C. ihumii (Merhej et al., 2015) stands out since it encodes a class I lantibiotic cluster in where until 11 putative lantibiotics with a high range of diversity could be processed by a unique lanBTC system (Figure 1). This kind of lantibiotic island has been not described to date in other bacteria. However, it has been described that some bacteria have the ability to produce many different lanthipeptides (with the codifying gene dispersed in the genome) using only one biosynthetic enzyme as the ubiquitous marine cyanobacteria Prochlorococcus or Synechococcus (Cubillos-Ruiz et al., 2017). None of the C. ihumii putative peptides selected for heterologous expression was produced by L. lactis. In fact, only the peptides named Clos2, Clos4, and Clos5 from C. beijerinckii HUN142 were produced. Five different putative lantibiotics were identified in the genome of this bacteria divided into two complete clusters (one close to the other). Together with Clos2, Clos4, and Clos5, a variant of streptin was also present in the genome.

All these Closx peptides showed a broad range of hetero-dehydration and some peaks observed in MALDI-ToF were matching with N-terminal leader peptide degradation (Figure 3). The purification of the pure form of a lantibiotic when it is hetero-dehydrated is laborious because of the impossibility to completely separate one fraction from the other. However, due to the differential hydrophobic properties of the lantibiotics depending on the dehydration level, in an RP-HPLC the more dehydrated forms elute later than, the less dehydrated (van Heel et al., 2016). Based on this and because the antimicrobial activity of the lantibiotics toward specific sensitive bacteria could be dehydration-level dependent, four HPLC fractions were assayed. In general, none displayed antimicrobial activity against the Gram-positive bacteria assayed and/or against Clostridium strains except a weak activity of fraction 4 of each peptide against B. cereus.

Nisin is well known to display potent antimicrobial activity against clostridial strains. However, as other antimicrobials, nisin is not active against spores (Mazzotta et al., 1997; Le Lay et al., 2016; El Jaam et al., 2017), and although there are still studies, nisin also seems to modify the gut microbiota (Gough et al., 2018; Jia et al., 2018). Based on this and following a synthetic biology approach, 10 differences peptides (AMVx) were designed by a combination of parts of nisin with parts of these putative lantibiotics. The idea was to obtain peptides as active as nisin and with specificity against Clostridium. Similar approaches to improve the activity of lantibiotics have recently published by Schmitt et al. (2019) but unlike that work, in this case, the lantibiotic used in the hybrid peptides are putative, the rings AB(C) part of nisin were changed in some of them and the design is focused toward a specific bacterial group, i.e., Clostridia.

Two groups of peptides were designed based on the use of the rings AB/ABC of CDE/DE of the nisin in combination with the putative rings of the peptides. Unlike Closx peptides, all the new designed were heterologously expressed in L. lactis, but only AMV5, AMV7, and AMV10 were produced in concentrations similar to nisin production (Figure 2). After MALDI-ToF analysis, a putative N-terminal leader degradation was observed in all the peptides as well as a putative C-terminal degradation in the case of the peptides AMV2, AMV4, and AMV6 (Figure 7). Interestingly, in these peptides and according to their sequence no C-terminal ring could be formed (unlike AMV1, AMV3, AMV5) indicating a protective effect. No C-terminal degradation was observed for the peptides in which the last part of nisin was cloned (AMV7, AMV8, AMV9, and AMV10) (Figures 6, 7). Finally, the N-terminal degradation of the leader was stronger for the peptides in which the C-terminal part of nisin was not present, suggesting that this part of nisin could be implicated in the resistance to proteases of prenisin. The presence and flexibility of the hinge region could be related to a major resistance to N-terminal degradation (Yuan et al., 2004; Zhou et al., 2015). In the case of AMV9, masses corresponding to the size of the peptide without the first four aa (AGAG) as well as a mass corresponding to the nisin leader were observed after the purification. We suggest that this peptide could be cleaved by another protease from the cell, e.g., by the intermembrane CAAX (CPBP family) proteases (Pei and Grishin, 2001; Pei et al., 2011). These proteases are related (at least) with the cleavage of class IIb bacteriocins (GG, GA, AG motifs) (Oliveira et al., 2017) and after a genome screening, at least five of these enzymes (llmg_0149, llmg_0198, llmg_0736, llmg_2326, and llmg_0852) are annotated in the chromosome of L. lactis MG1363 (mother strain of NZ9000).

With regard to the activity, none of the designed peptides displayed antimicrobial activity against the Gram-positive bacteria tested, with some exceptions. The HPLC fraction 4 of the truncated peptide AMV6 against B. cereus and the fractions 2, 3, and 4 of AMV10 against S. salivarius. A weak activity of the fraction of AMV1 and AMV8 was also observed against B. cereus. Interestingly, two peptides showed an evident activity against Clostridium strains, the fraction 4 of AMV5 and especially the fraction 2 of AMV10. In the case of AMV10 and unlike in S. salivarius, the active HPLC fractions were the numbers 1 and 2. This suggests that the dehydration level could be related to the specificity against certain bacteria.

Finally, the peptides AMV5 and AMV10 were selected for an extensive test against six different Clostridium strains. Concentrations ranging from 32 to 0.007 μg/mL were tested. We found that AMV10 is a potent peptide against pathogenic clostridia such as C. difficile or C. botulinum. Notably, AMV10 was not active against C. beijerinckii. AMV10 was obtained by the combination of the first two putative rings of Clos4 with the rings CDE of nisin, and Clos4 is a putative lantibiotic identified in the genome of other C. beijerinckii (Figure 6). This suggests that these strains could present specific resistance to these peptides and that the specificity toward clostridia is more related to the first rings (i.e., lipid II binding domain) than with the last one. However, C. beijerinckii was sensitive to AMV5 at the higher tested concentration as well as C. ihumii and C. botulinum. In this case, the first rings of the designed peptides are from C. perfringens. The rest of the species tested were resistant (Table 6). Respect the ring installation, only the peptide AMV10 with −9H2O is able to form all the rings. That means that probably only around the 10% of this peptide (Table 4) is the most active.

Conclusion

The primary objective of this work was the development of new antimicrobials with high specificity and activity against specific clostridial strains, especially pathogenic Clostridia as C. difficile. Using the combination of two different methodologies, genome mining of clostridial genomes and synthetic biology, 20 different peptides were heterologously expressed in L. lactis obtaining at the end two peptides (AMV5 and specially AMV10) that fulfilled the requirements set in this work: good heterologous expression levels and high specificity and activity toward Clostridium. The high specificity and activity observed for peptide AMV10 makes it a good candidate as an alternative to traditional antibiotics in the treatment of C. difficile infections, avoiding the side effects and the damage on the gut microbiota.

Finally, the methodology applied in this work has shown its robustness in the identification and design of new peptides with specificity and high activity against specific bacteria and could be applied for other fastidious bacteria which are hard to treat, such as Mycobacterium or Gram-negative/positive ESKAPE bacteria.

Statements

Data availability statement

The datasets generated for this study are available on request to the corresponding author.

Author contributions

OK supervised the work. RC and OK conceived and designed the experiments. RC, AM-V, and AJ collected and analyzed the data. RC and OK wrote and reviewed the manuscript. All authors read and approved the final manuscript.

Funding

RC was financially supported by the Spanish Ramon Areces Foundation and by the NWO-NACTAR (Project number 16433) program to enable this work. AJ was sponsored by the LPDP scholarship, from the Ministry of Finance of Republic of Indonesia, during his master degree in the University of Groningen.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fmicb.2019.02154/full#supplementary-material

FIGURE S1

MALDI-ToF data of the NisP leader cleavage efficiency for Clos2, Clos4, Clos5, and nisin during 3 h.

FIGURE S2

MALDI-ToF data of the NisP leader cleavage efficiency for AMVx peptides before (in blue) and after 3 h (in green).

TABLE S1

Putative lantibiotics identified in Clostridium ssp. genomes after the genome mining, and NCBI genome reference number.

References

  • 1

    AbtsA.Montalban-LopezM.KuipersO. P.SmitsS. H.SchmittL. (2013). NisC binds the FxLx motif of the nisin leader peptide.Biochemistry5253875395. 10.1021/bi4008116

  • 2

    AktypisA.KalantzopoulosG.Huis in’t VeldJ. H.ten BrinkB. (1998). Purification and characterization of thermophilin T, a novel bacteriocin produced by Streptococcus thermophilus ACA-DC 0040.J. Appl. Microbiol.84568576. 10.1046/j.1365-2672.1998.00383.x

  • 3

    Alvarez-SieiroP.Montalbán-LópezM.MuD.KuipersO. P. (2016). Bacteriocins of lactic acid bacteria: extending the family.Appl. Microbiol. Biotechnol.10029392951. 10.1007/s00253-016-7343-9

  • 4

    BauerM. P.NotermansD. W.van BenthemB. H. B.BrazierJ. S.WilcoxM. H.RupnikM.et al (2011). Clostridium difficile infection in Europe: a hospital-based survey.Lancet3776373. 10.1016/S0140-6736(10)61266-4

  • 5

    BreukinkE.de KruijffB. (2006). Lipid II as a target for antibiotics.Nat. Rev. Drug. Discov.5321332. 10.1038/nrd2004

  • 6

    Candel-PérezC.Ros-BerruezoG.Martínez-GraciáC. (2019). A review of Clostridioides [Clostridium] difficile occurrence through the food chain.Food Microbiol.77118129. 10.1016/j.fm.2018.08.012

  • 7

    CassirN.BenamarS.La ScolaB. (2016). Clostridium butyricum: from beneficial to a new emerging pathogen.Clin. Microbiol. Infect.223745. 10.1016/j.cmi.2015.10.014

  • 8

    CebriánR.BañosA.ValdiviaE.Pérez-PulidoR.Martínez-BuenoM.MaquedaM. (2012). Characterization of functional, safety, and probiotic properties of Enterococcus faecalis UGRA10, a new AS-48-producer strain.Food Microbiol.305967. 10.1016/j.fm.2011.12.002

  • 9

    ChengY.-W.PhelpsE.GanapiniV.KhanN.OuyangF.XuH.et al (2019). Fecal microbiota transplantation for the treatment of recurrent and severe Clostridium difficile infection in solid organ transplant recipients: a multicenter experience.Am. J. Transplant.19501511. 10.1111/ajt.15058

  • 10

    CollinsJ.AuchtungJ. M. (2017). Control of Clostridium difficile infection by defined microbial communities.Microbiol. Spectr.5:BAD-0009-2016. 10.1128/microbiolspec.BAD-0009-2016

  • 11

    Cubillos-RuizA.Berta-ThompsonJ. W.BeckerJ. W.van der DonkW. A.ChisholmS. W. (2017). Evolutionary radiation of lanthipeptides in marine cyanobacteria.Proc. Natl. Acad. Sci. U.S.A.114E5424E5433. 10.1073/pnas.1700990114

  • 12

    CzepielJ.DróżdżM.PituchH.KuijperE. J.PeruckiW.MielimonkaA.et al (2019). Clostridium difficile infection: review.Eur. J. Clin. Microbiol. Infect. Dis.3812111221. 10.1007/s10096-019-03539-6

  • 13

    de RuyterP. G.KuipersO. P.de VosW. M. (1996). Controlled gene expression systems for Lactococcus lactis with the food-grade inducer nisin.Appl. Environ. Microbiol.6236623667.

  • 14

    de VosW. M.KuipersO. P.van der MeerJ. R.SiezenR. J. (1995). Maturation pathway of nisin and other lantibiotics: post-translationally modified antimicrobial peptides exported by gram-positive bacteria.Mol. Microbiol.17427437. 10.1111/j.1365-2958.1995.mmi_17030427.x

  • 15

    DicksL. M. T.MikkelsenL. S.BrandsborgE.MarcotteH. (2018). Clostridium difficile, the difficult “kloster” fuelled by antibiotics.Curr. Microbiol.76774782. 10.1007/s00284-018-1543-8

  • 16

    El JaamO.FlissI.AïderM. (2017). Effect of electro-activated aqueous solutions, nisin and moderate heat treatment on the inactivation of Clostridium sporogenes PA 3679 spores in green beans puree and whole green beans.Anaerobe47173182. 10.1016/j.anaerobe.2017.05.017

  • 17

    FatimaR.AzizM. (2019). The hypervirulent strain of Clostridium difficile: NAP1/B1/027 - A brief overview.Cureus11:e3977. 10.7759/cureus.3977

  • 18

    Geu-FloresF.Nour-EldinH. H.NielsenM. T.HalkierB. A. (2007). USER fusion: a rapid and efficient method for simultaneous fusion and cloning of multiple PCR products.Nucleic Acids Res.35:e55. 10.1093/nar/gkm106

  • 19

    GoughR.Cabrera RubioR.O’ConnorP. M.CrispieF.BrodkorbA.MiaoS.et al (2018). Oral delivery of nisin in resistant starch based matrices alters the gut microbiota in mice.Front. Microbiol.9:1186. 10.3389/fmicb.2018.01186

  • 20

    GreenR.RogersE. J. (2013). Chemical transformation of E. coli.Methods Enzymol.529329336. 10.1016/B978-0-12-418687-3.00028-8

  • 21

    GroteA.HillerK.ScheerM.MünchR.NörtemannB.HempelD. C.et al (2005). JCat: a novel tool to adapt codon usage of a target gene to its potential expression host.Nucleic Acids Res.33W526W531. 10.1093/nar/gki376

  • 22

    HasperH. E.KramerN. E.SmithJ. L.HillmanJ. D.ZachariahC.KuipersO. P.et al (2006). An alternative bactericidal mechanism of action for lantibiotic peptides that target lipid II.Science31316361637. 10.1126/science.1129818

  • 23

    HockettK. L.BaltrusD. A. (2017). Use of the soft-agar overlay technique to screen for bacterially produced inhibitory compounds.J. Vis. Exp.119:55064. 10.3791/55064

  • 24

    HoloH.NesI. F. (1995). Transformation of Lactococcus by electroporation.Methods Mol. Biol.47195199. 10.1385/0-89603-310-4.195

  • 25

    HudsonG. A.MitchellD. A. (2018). RiPP antibiotics: biosynthesis and engineering potential.Curr. Opin. Microbiol.456169. 10.1016/j.mib.2018.02.010

  • 26

    JiaZ.ChenA.BaoF.HeM.GaoS.XuJ.et al (2018). Effect of nisin on microbiome-brain-gut axis neurochemicals by Escherichia coli-induced diarrhea in mice.Microb. Pathog.1196571. 10.1016/j.micpath.2018.04.005

  • 27

    KiuR.HallL. J. (2018). An update on the human and animal enteric pathogen Clostridium perfringens.Emerg. Microbes Infect.7:141. 10.1038/s41426-018-0144-8

  • 28

    KleerebezemM.BoekhorstJ.van KranenburgR.MolenaarD.KuipersO. P.LeerR.et al (2003). Complete genome sequence of Lactobacillus plantarum WCFS1.Proc. Natl. Acad. Sci. U.S.A.10019901995. 10.1073/pnas.0337704100

  • 29

    Le LayC.DridiL.BergeronM. G.OuelletteM.FlissI. L. (2016). Nisin is an effective inhibitor of Clostridium difficile vegetative cells and spore germination.J. Med. Microbiol.65169175. 10.1099/jmm.0.000202

  • 30

    LewiesA.Du PlessisL. H.WentzelJ. F. (2018). Antimicrobial peptides: the Achilles’ heel of antibiotic resistance?Probiotics Antimicrob. Proteins11370381. 10.1007/s12602-018-9465-0

  • 31

    MastrantonioP.RupnikM. (2018). “Erratum to: updates on Clostridium difficile in Europe,” in Updates on Clostridium difficile in Europe. Advances in Experimental Medicine and Biology, edsMastrantonioP.RupnikM. (Cham: Springer).

  • 32

    MathiasF.CurtiC.MontanaM.BornetC.VanelleP. (2019). Management of adult Clostridium difficile digestive contaminations: a literature review.Eur. J. Clin. Microbiol. Infect. Dis.38209231. 10.1007/s10096-018-3419-z

  • 33

    MazzottaA. S.CrandallA. D.MontvilleT. J. (1997). Nisin resistance in Clostridium botulinum spores and vegetative cells.Appl. Environ. Microbiol.6326542659.

  • 34

    MerhejV.PfleidererA.RamasamyD.LagierJ.-C.MichelleC.RaoultD.et al (2015). Non-contiguous finished genome sequence and description of Clostridium ihumii sp. nov.Stand Genomic Sci.10:63. 10.1186/s40793-015-0025-x

  • 35

    MillerA. C.PolgreenL. A.CavanaughJ. E.PhilipM.VernonM.CityI.et al (2016). Hospital Clostridium difficile infection (CDI) incidence as a risk factor for hospital-associated CDI.Am. J. Infect Control44825829. 10.1016/j.ajic.2016.01.006.Hospital

  • 36

    Montalbán-LópezM.DengJ.van HeelA. J.KuipersO. P. (2018). Specificity and application of the lantibiotic protease NisP.Front. Microbiol.9:160. 10.3389/fmicb.2018.00160

  • 37

    Montalbán-LópezM.van HeelA. J.KuipersO. P. (2017). Employing the promiscuity of lantibiotic biosynthetic machineries to produce novel antimicrobials.FEMS Microbiol. Rev.41518. 10.1093/femsre/fuw034

  • 38

    MullishB. H.WilliamsH. R. (2018). Clostridium difficile infection and antibiotic-associated diarrhoea.Clin. Med.18237241. 10.7861/clinmedicine.18-3-237

  • 39

    NelsonR. (2007). Antibiotic treatment for Clostridium difficile-associated diarrhea in adults.Cochrane Database Syst. Rev.3:CD004610. 10.1002/14651858.CD004610.pub3

  • 40

    OliveiraL.SilveiraA. M. M.MonteiroA. S.dos SantosV. L.NicoliJ. R.AzevedoV. A. C.et al (2017). In silico prediction, in vitro antibacterial spectrum, and physicochemical properties of a putative bacteriocin produced by Lactobacillus rhamnosus Strain L156.4.Front. Microbiol.8:876. 10.3389/fmicb.2017.00876

  • 41

    PeiJ.GrishinN. V. (2001). Type II CAAX prenyl endopeptidases belong to a novel superfamily of putative membrane-bound metalloproteases.Trends Biochem. Sci.26275277. 10.1016/s0968-0004(01)01813-8

  • 42

    PeiJ.MitchellD. A.DixonJ. E.GrishinN. V. (2011). Expansion of type II CAAX proteases reveals evolutionary origin of γ-secretase subunit APH-1.J. Mol. Biol.4101826. 10.1016/j.jmb.2011.04.066

  • 43

    PengZ.JinD.KimH. B.StrattonC. W.WuB.TangY.-W.et al (2017). Update on Antimicrobial resistance in Clostridium difficile: resistance mechanisms and antimicrobial susceptibility Testing.J. Clin. Microbiol.5519982008. 10.1128/JCM.02250-16

  • 44

    PlatA.KuipersA.RinkR.MollG. N. (2013). Mechanistic aspects of lanthipeptide leaders.Curr. Protein Pept. Sci.148596. 10.1016/S0968-0004(01)01813-8

  • 45

    RamaiD.ZakhiaK.OfosuA.OforiE.ReddyM. (2019). Fecal microbiota transplantation: donor relation, fresh or frozen, delivery methods, cost-effectiveness.Ann. Gastroenterol.323038. 10.20524/aog.2018.0328

  • 46

    RepkaL. M.ChekanJ. R.NairS. K.van der DonkW. A. (2017). Mechanistic understanding of lanthipeptide biosynthetic enzymes.Chem. Rev.11754575520. 10.1021/acs.chemrev.6b00591

  • 47

    RinkR.KuipersA.de BoefE.LeenhoutsK. J.DriessenA. J. M.MollG. N.et al (2005). Lantibiotic structures as guidelines for the design of peptides that can be modified by lantibiotic enzymes.Biochemistry4488738882. 10.1021/bi050081h

  • 48

    SahlH. G.JackR. W.BierbaumG. (1995). Biosynthesis and biological activities of lantibiotics with unique post-translational modifications.Eur. J. Biochem.230827853. 10.1111/j.1432-1033.1995.0827g.x

  • 49

    SambrookJ.FritschE. F.ManiatisT. (1990). Molecular Cloning: A Laboratory Manual.New York, NY: Cold Spring Harbor Laboratory Press.

  • 50

    Sasi JyothsnaT. S.TusharL.SasikalaC.RamanaC. V. (2016). Erratum to Paraclostridium benzoelyticum gen. nov. sp. nov., isolated from marine sediment and reclassification of Clostridium bifermentans as Paraclostridium bifermentans comb. nov. Proposal of a new genus Paeniclostridium gen. nov. to accommodate Clostridium sordellii and Clostridium ghonii.Int. J. Syst. Evol. Microbiol.66:2459. 10.1099/ijsem.0.001144

  • 51

    SchmittS.Montalbán-LópezM.PeterhoffD.DengJ.WagnerR.HeldM.et al (2019). Analysis of modular bioengineered antimicrobial lanthipeptides at nanoliter scale.Nat. Chem. Biol.15437443. 10.1038/s41589-019-0250-5

  • 52

    SeoB.YooJ. E.LeeY. M.KoG. (2017). Merdimonas faecis gen. nov., sp. nov., isolated from human faeces.Int. J. Syst. Evol. Microbiol.6724302435. 10.1099/ijsem.0.001977

  • 53

    SongH. J.ShimK.-N.JungS.-A.ChoiH. J.LeeM. A.RyuK. H.et al (2008). Antibiotic-associated diarrhea: candidate organisms other than Clostridium difficile.Korean J. Intern. Med.23915. 10.3904/kjim.2008.23.1.9

  • 54

    SongJ. H.KimY. S. (2019). Recurrent Clostridium difficile infection: risk factors, treatment, and prevention.Gut Liver131624. 10.5009/gnl18071

  • 55

    TodorovS. D.de Melo FrancoB. D. G.TaggJ. R. (2019). Bacteriocins of Gram-positive bacteria having activity spectra extending beyond closely-related species.Benef. Microbes10315328. 10.3920/BM2018.0126

  • 56

    UdaondoZ.DuqueE.RamosJ.-L. (2017). The pangenome of the genus Clostridium.Environ. Microbiol.1925882603. 10.1111/1462-2920.13732

  • 57

    Van den BogertB.BoekhorstJ.HerrmannR.SmidE. J.ZoetendalE. G.KleerebezemM. (2013). Comparative genomics analysis of Streptococcus isolates from the human small intestine reveals their adaptation to a highly dynamic ecosystem.PLoS One8:e083418. 10.1371/journal.pone.0083418

  • 58

    van der MeerJ. R.RollemaH. S.SiezenR. J.BeerthuyzenM. M.KuipersO. P.de VosW. M. (1994). Influence of amino acid substitutions in the nisin leader peptide on biosynthesis and secretion of nisin by Lactococcus lactis.J. Biol. Chem.26935553562.

  • 59

    van HeelA. J.de JongA.SongC.VielJ. H.KokJ.KuipersO. P. (2018). BAGEL4: a user-friendly web server to thoroughly mine RiPPs and bacteriocins.Nucleic Acids Res.46W278W281. 10.1093/nar/gky383

  • 60

    van HeelA. J.KloostermanT. G.Montalban-LopezM.DengJ.PlatA.BauduB.et al (2016). Discovery, production and modification of five novel lantibiotics using the promiscuous nisin modification machinery.ACS Synth. Biol.511461154. 10.1021/acssynbio.6b00033

  • 61

    van HeelA. J.Montalban-LopezM.KuipersO. P. (2011). Evaluating the feasibility of lantibiotics as an alternative therapy against bacterial infections in humans.Expert Opin. Drug Metab. Toxicol.7675680. 10.1517/17425255.2011.573478

  • 62

    van HeelA. J.MuD.Montalbán-LópezM.HendriksD.KuipersO. P. (2013). Designing and producing modified, new-to-nature peptides with antimicrobial activity by use of a combination of various lantibiotic modification enzymes.ACS Synth. Biol.2397404. 10.1021/sb3001084

  • 63

    van KraaijC.de VosW. M.SiezenR. J.KuipersO. P. (1999). Lantibiotics: biosynthesis, mode of action and applications.Nat. Prod. Rep.16575587. 10.1039/a804531c

  • 64

    VenturaM.TurroniF.van SinderenD. (2015). “Chapter 4-bifidobacteria of the human gut: our special friends,” in Diet-Microbe Interactions in the Gut, edsTuohyK.Del RioD. (San Diego, CA: Academic Press), 4151. 10.1016/B978-0-12-407825-3.00004-6

  • 65

    WangS.XuM.WangW.CaoX.PiaoM. (2016). Systematic review : adverse events of fecal microbiota transplantation.PLoS One11:e0161174. 10.1371/journal.pone.0161174

  • 66

    WeberT.BlinK.DuddelaS.KrugD.KimH. U.BruccoleriR.et al (2015). antiSMASH 3.0—a comprehensive resource for the genome mining of biosynthetic gene clusters.Nucleic Acids Res.43W237W243. 10.1093/nar/gkv437

  • 67

    WegmannU.O’Connell-MotherwayM.ZomerA.BuistG.ShearmanC.CanchayaC.et al (2007). Complete genome sequence of the prototype lactic acid bacterium Lactococcus lactis subsp. cremoris MG1363.J. Bacteriol.18932563270. 10.1128/JB.01768-06

  • 68

    WilkinsM. R.GasteigerE.BairochA.SanchezJ. C.WilliamsK. L.AppelR. D.et al (1999). Protein identification and analysis tools in the ExPASy server.Methods Mol. Biol.112531552. 10.1385/1-59259-584-7:531

  • 69

    YakobL.RileyT. V.PatersonD. L.MarquessJ.MagalhaesR. J. S.Furuya-KanamoriL.et al (2015). Mechanisms of hypervirulent Clostridium difficile ribotype 027 displacement of endemic strains: an epidemiological model.Sci. Rep.5:12666. 10.1038/srep12666

  • 70

    YangS.-C.LinC.-H.SungC. T.FangJ.-Y. (2014). Antibacterial activities of bacteriocins: application in foods and pharmaceuticals.Front. Microbiol.5:241. 10.3389/fmicb.2014.00241

  • 71

    YangX.van der DonkW. A. (2015). The Michael-type cyclizations in lantibiotic biosynthesis are reversible.ACS Chem. Biol.1012341238. 10.1021/acschembio.5b00007

  • 72

    YuanJ.ZhangZ.-Z.ChenX.-Z.YangW.HuanL.-D. (2004). Site-directed mutagenesis of the hinge region of nisin Z and properties of nisin Z mutants.Appl. Microbiol. Biotechnol.64806815. 10.1007/s00253-004-1599-1

  • 73

    ZacharofM. P.LovittR. W. (2012). Bacteriocins produced by lactic acid bacteria a review article.APCBEE Procedia25056. 10.1016/j.apcbee.2012.06.010

  • 74

    ZhouL.van HeelA. J.KuipersO. P. (2015). The length of a lantibiotic hinge region has profound influence on antimicrobial activity and host specificity.Front. Microbiol.6:11. 10.3389/fmicb.2015.00011

Summary

Keywords

genome mining, Clostridium difficile, antimicrobial susceptibility, lantibiotic design, nisin

Citation

Cebrián R, Macia-Valero A, Jati AP and Kuipers OP (2019) Design and Expression of Specific Hybrid Lantibiotics Active Against Pathogenic Clostridium spp.. Front. Microbiol. 10:2154. doi: 10.3389/fmicb.2019.02154

Received

14 May 2019

Accepted

02 September 2019

Published

24 September 2019

Volume

10 - 2019

Edited by

Tomasz M. Karpiński, Poznań University of Medical Sciences, Poland

Reviewed by

Sander H. J. Smits, Heinrich-Heine-Universität Düsseldorf (HHU), Germany; Melinda J. Mayer, Quadram Institute, United Kingdom

Updates

Copyright

*Correspondence: Oscar P. Kuipers,

This article was submitted to Antimicrobials, Resistance and Chemotherapy, a section of the journal Frontiers in Microbiology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics