Abstract
Mycobacterium avium subspecies hominissuis (MAH) is the most common agent causing nontuberculous mycobacterial disease in humans. It mainly causes chronic and slowly progressive pulmonary disease (PD), which requires a long-term treatment and allows opportunistic co-infection by common pulmonary pathogens such as Pseudomonas aeruginosa, Staphylococcus aureus, and Aspergillus spp., thereby resulting in alteration of host immune response. In the present study, we investigated the phenotypical and functional alterations of dendritic cells (DCs), a bridge antigen-presenting cell between innate and adaptive immunity, following MAH infection in response to various toll-like receptor (TLR) agonists mimicking co-infection conditions, along with subsequent T cell response. Interestingly, MAH-infected DCs produced interleukin (IL)-10 significantly and decreased the level of IL-12p70 in response to Poly I:C and LPS, although not so in response to Pam3CSK4, imiquimod, or CpG oligodeoxynucleotide, thereby indicating that the TLR3 and TLR4 agonists functionally altered MAH-infected DCs toward a tolerogenic phenotype. Moreover, IL-10-producing tolerogenic DCs were remarkably induced by MAH and P. aeruginosa co-infection. To precisely elucidate how these TLR agonists induce tolerogenic DCs upon MAH infection, we sought to clarify the major mechanisms involved, using LPS, which caused the greatest increase in IL-10 production by the TLR agonists. Increased IL-10 stimulated the creation of tolerogenic DCs by significantly reducing MHC class II expression and MHC class II-antigen presentation, eventually inhibiting CD4+ T cell proliferation, along with decreased IFN-γ and IL-2. The tolerogenic phenotypes of MAH/LPS-treated DCs were restored by anti-IL-10 neutralization, validating the induction of tolerogenicity by IL-10. Interestingly, IL-10-producing-tolerogenic DCs were observed after infection with live MAH, rather than with inactivated or dead MAH. In addition, TLR2−/− and TLR4−/− DCs confirmed the association of IL-10 production with TLR2 and TLR4 signaling; IL-10 production synergistically increased when both TLR4 and TLR2 were involved. Expression of Cox2 and PGE2 increased along with IL-10 while that of IL-10 was inhibited by their selective inhibitors celecoxib and anti-EP2 antibody, respectively. Thus, the tolerogenic phenotypes of MAH/LPS-treated DCs were proven to be induced by Cox-2/PGE2-dependent EP2 signaling as the main mechanism. These findings may provide important clues that the tolerogenic cascade in MAH-infected DCs induced by TLR 4 signaling can alter host immune response.
Introduction
Mycobacterium avium subspecies hominissuis (MAH), which belongs to the M. avium complex (MAC), is emerging as an important pathogen in pulmonary diseases (PD) caused by nontuberculous mycobacterial (NTM) infection in humans, despite the decreasing incidence of tuberculosis globally (Prevots and Marras, 2015; Meier et al., 2017). The prevalence of chronic lung diseases, such as chronic obstructive pulmonary disease (COPD), cystic fibrosis (CF), and bronchiectasis, and HIV infection have increased, and the use of immunosuppressive medication has increased, resulting in increased frequency of NTM infection (Thomson, 2010; Bonaiti et al., 2015). Recently, patients with NTM-PD were seen to be frequently co-infected with other NTM species or microorganisms (Wickremasinghe et al., 2005; Kunst et al., 2006; Fujita et al., 2014; Bonaiti et al., 2015). Especially, Pseudomonas aeruginosa (P. aeruginosa) has been reported to range from 27 to 52% and is the most frequent co-infection with NTM (Wickremasinghe et al., 2005; Zoumot et al., 2014; Bonaiti et al., 2015). According to Wickremasinghe et al. (2005), P. aeruginosa was isolated in 52% of patients co-infected with NTM in a retrospective analysis of 100 patients with bronchiectasis (Wickremasinghe et al., 2005). Staphylococcus aureus (28%), Haemophilus influenzae (12%), Candida albicans (8%), Aspergillus fumigatus (4%), and Stenotrophomonas maltophilia (4%) were the other frequent co-pathogens in the same study (Wickremasinghe et al., 2005; Bonaiti et al., 2015). Fujita et al. (2014) identified pathogenic co-infection of non-MAC pathogens, isolated from the sputum samples of 275 patients with MAC-PD between 2001 and 2013; 45.1, 14.9, and 40% patients with MAC-PD showed chronic, intermittent, and no co-infection, respectively (Fujita et al., 2014). The main co-infecting microorganisms from the above findings were S. aureus, P. aeruginosa, and Aspergillus spp. in higher order (Fujita et al., 2014). In particular, these three major microorganisms chronically infected patients with MAC-PD, accounting for 71.9% of S. aureus infection, 77.8% of P. aeruginosa infection, and 62.1% of Aspergillus spp. infection (Fujita et al., 2014). P. aeruginosa was reported to be more frequently isolated during MAC treatment (75%) or after MAC sputum conversion (93.1%) than during MAC-positive sputum culture (25.7%) (Fujita et al., 2014). This implies that P. aeruginosa may be able to infect intermittently, but the most P. aeruginosa infection can affect chronically patients with MAC (Fujita et al., 2014). Chronic co-infection of P. aeruginosa is known to be associated with a wide range of lesions in the lower lobe of lung and can affect lung function and disease severity (Fujita et al., 2014; Hsieh et al., 2018).
While cellular mechanisms for mycobacterial infection, such as pathogenesis and immune response, have been relatively well studied, the studies have been limited to single mycobacterial species. Therefore, the phenotypic and functional alterations of immune cells are not yet clearly understood in MAH and other microorganism co-infection. Dendritic cells (DCs), as professional antigen presenting cells linking innate and acquired immunity, prime T cells after migration to secondary lymph node, and induce subsequent T cell responses (Jiao et al., 2002; Kim et al., 2017). In other words, the initial immune response that MAH and other microorganisms encounter may take place in DCs, which ultimately determine the direction of T cell response (Kim et al., 2017). Toll-like receptors (TLRs) expressed on dendritic cell surfaces play an important role in recognizing specific bacterial, viral, and fungal structural molecules known as pathogen-associated molecular patterns (PAMPs) and initiating innate immune responses (Mogensen, 2009; Feng et al., 2019). TLRs are also known to play a pivotal role in mycobacterial infections (Mahla et al., 2013). TLR2 has been reported to be a major receptor that plays an important role in the recognition of major mycobacterial surface components, such as lipoprotein and lipoarabinomannan, and in the control of M. avium infection (Yoshimura et al., 1999; Jones et al., 2001). Other TLRs have also been shown to recognize M. avium and induce specific immune responses. TLR4, which is known as a receptor for Gram-negative bacterial LPS, is involved in signal transduction via the heat-labile cell wall proteins of mycobacteria (Quesniaux et al., 2004). TLR6 and TLR9 have also been reported to recognize lipoproteins and mycobacterial DNA and induce a host inflammatory response against mycobacteria (Bafica et al., 2005; Marinho et al., 2013). Additionally, various TLR agonists are also used as agents to mimic the mechanism of immune-cell stimulation by microbial signals (Feng et al., 2019); for example, Pam3CSK4 (mimicking bacterial lipopeptide; agonist of TLR1/2) (Werling et al., 2009), polyinosinic:polycytidylic acid (poly I:C, a synthetic double-stranded RNA (dsRNA); agonist of TLR3) (Matsumoto and Seya, 2008), lipopolysaccharide (LPS, a cell-wall component of Gram-negative bacteria; agonist of TLR4) (Bryant et al., 2010), imiquimod (a synthetic imidazoquinolone amine, which has potent immune response modifier activity; agonist of TLR7) (Sauder, 2000), and CpG oligodeoxynucleotide (CpG ODN, short single-stranded synthetic DNA molecule; agonist of TLR9) (Bauer et al., 2001).
In the present study, we aimed to analyze the immune response of DCs by stimulating with various TLR agonists to mimic co-infection, ultimately to identify T cell responses in MAH-infected DCs. We described a specific immune response of MAH-infected DCs in response to the various TLR stimuli and explored a major mechanism driving it. Our results provide important clues for the identification of complex immune mechanisms activated by MAH co-infection.
Materials and Methods
Cell Culture
Bone marrow cells isolated from WT, TLR2 knockout (TLR2−/−), and TLR4−/− mice (C57BL/6 backgrounds, Jackson Laboratory, Bar Harbor, ME, USA) at 6–7 weeks of age was cultured at 37°C in the presence of 5% CO2 using RPMI medium (GIBCO, Carlsbad, CA, USA) supplemented with 20 ng/ml GM-CSF (JW Creagene, Gyeonggi, Korea), 10% fetal bovine serum (FBS, Lonza, Basel, Switzerland), and 1% antibiotics (penicillin/streptomycin, Lonza). On day eight, the CD11c+ cell fraction was labeled with a bead-conjugated anti-CD11c monoclonal antibody (mAb; Miltenyi Biotec, San Diego, CA, USA) and separated by sequential passages using LS columns (Miltenyi Biotec). Purity of the selected bone marrow-derived DCs (BMDCs) CD11c+ fractions was >95%.
Cytokine Analysis in Culture Supernatants
To investigate the cytokine pattern induced in MAH-infected BMDCs by treatment with TLR ligands, selected BMDCs were infected with MAH 104 [multiplicity of infection (MOI) of 1] for 2 h prior to treatment with Pam3CSK4 (TLR2 ligand), poly I:C (TLR3 ligand), LPS from Escherichia coli O111:B4 (TLR4 ligand), imiquimod (R837, TLR7 ligand), and ODN1826 (TLR9 ligand) for 24 h at 37°C. To investigate the cytokine pattern induced in BMDCs exposed to TLR ligands by infection with MAH 104, BMDCs were treated with each TLR ligand (TLR2, 3, 4, 7, and 9) for 2 h prior to infection with MAH 104 for 24 h at 37°C. Finally, to investigate the cytokine pattern induced by co-treatment with MAH 104 and TLR stimulators (TLR ligands, P. aeruginosa PA01, or P. aeruginosa NCCP14781), BMDCs were treated with MAH 104 and TLR ligands, P. aeruginosa PA01 and TLR ligands, or P. aeruginosa NCCP14781 and TLR ligands (representative Gram-negative bacteria; MOI of 0.1, 0.5, and 1) for 24 h at 37°C. To determine cytokine concentrations, culture supernatants were analyzed using the sandwich ELISA kit (eBioscience, San Diego, CA, USA) according to the manufacturer’s instructions. All TLR ligands were obtained from Invivogen (San Diego, CA, USA).
Cell Viability Assay
For Annexin V and PI staining, BMDCs were infected with MAH (MOI of 1) in the presence or absence of LPS (100 ng/ml) at 37°C. After 24 h, the cells were harvested, washed twice with PBS, and stained using Annexin V and PI apoptosis Detection kit (BD Bioscience, San Jose, CA, USA) according to the manufacturer’s instructions. The cells were analyzed using a LSRII flow cytometer (Becton Dickinson, San Jose, CA, USA). Under the same culture conditions for Annexin V and PI staining, Cell Counting Kit-8 (CCK-8) reagent (Dojindo Laboratories, Tabaru, Japan) was added according to the manufacturer’s instructions to each well for 1 h at 37°C. Viable cells were analyzed by the absorbance at 450 nm, using a microplate ELISA reader.
Expression of Surface Molecules for Dendritic Cells
The cells (non-, LPS-, MAH-, MAH/LPS-treated DCs) were harvested, washed twice with PBS, and stained using anti-CD11c, anti-CD80, anti-CD86, anti-MHC-I, and anti-MHC-II mAbs for 30 min at 4°C. Thereafter, cells were washed three times with PBS, analyzed using a LSRII flow cytometer, and examined using FlowJo software. All surface antibodies were obtained from eBioscience.
Intracellular Cytokine Staining
Stimulated cells were treated with GolgiPlug for 12 h, stained with anti-CD11c Ab for 20 min at room temperature (RT), and then fixed and permeabilized with a Cytofix/Cytoperm kit (BD Bioscience) following the manufacturer’s instructions. Next, anti-TNF-α (eBioscience), anti-IL-12p70 (eBioscience), and anti-IL-10 (eBioscience) Abs were stained with fluorescein-conjugated secondary Abs in a permeabilization buffer and analyzed using a LSRII flow cytometer.
Antigen-Presenting Ability
To investigate the differences in peptide-MHC-I and -MHC-II complex formations in the absence and presence of MAH infection, cells were stimulated with either no treatment (non), LPS, MAH, or LPS and MAH, in the presence of 500 μg/ml OVA protein or 25 μg/ml Eα44–76 peptide (RLEEFAKFASFEAQGALANIAVDKANLDVMKKR; underlined sequence bound to MHC-II). OVA257–264 peptide (SIINFEKL) or Eα52–68 peptide (ASFEAQGALANIAVDKA) acts as a positive control for peptide formations of MHC-I or MHC-II, respectably. After 24 h of treatment, each cell was stained with anti-CD11c, anti-H-2Kb (SIINFEKL, eBioscience), or anti-I-Ab-Eα52–68 (Y-Ae; ASFEAQGALANIAVDKA, eBioscience) mAbs for 30 min at 4°C. Data were collected on LSRII and analyzed using FlowJo software. All peptides were synthesized by AbFrontier (Seoul, Korea).
Mixed Lymphocyte Reaction
Each single-cell suspension, isolated from the spleens of OVA-specific T cell receptor transgenic mice (OT-I and OT-II mice from C57BL/6 backgrounds) and BALB/C mice were labeled with bead-conjugated anti-CD4 and anti-CD8 mAbs (Miltenyi Biotec) and separated by sequential passaging using LS columns. Selected cells were stained with CFSE (5 μM, eBioscience) at 37°C and then washed with PBS (supplemented with 2% FBS) after 15 min. Next, in the presence or absence of OVA-specific OVA323–339 or OVA257–264 treatments, the cells (non-, LPS-, MAH-, MAH/LPS-treated DCs) were co-cultured with CFSE-labeled T cells (from naïve BALB/C, OT-I, or OT-II mice) at a DC to a T cell ratio of 0.5:1. After 3 days of co-culture, cells were harvested and stained with anti-CD4 and anti-CD8 mAbs (eBioscience). Data were collected on LSRII and analyzed using the FlowJo software. Cytokines, including IFN-γ and IL-2, were analyzed from the culture supernatants using cytokine-specific ELISA kits (eBioscience), following the manufacturer’s instructions.
Heat and Paraformaldehyde Inactivation for Mycobacterium avium subspecies hominissuis
In cell cultures with MAH, MAH were killed either by heating at 100°C for 30 min or by a 1-h incubation at RT in 4% (w/v) paraformaldehyde (PFA). Bacteria inactivated with PFA were extensively washed off with PBS. In the presence or absence of heat or PFA inactivation, the production of cytokines in non-, LPS-, MAH-, and MAH/LPS-treated DCs was analyzed using ELISA.
Immunoblot Analyses
For the cytosolic fraction, cells were lysed with RIPA lysis buffer (Pierce, Rockford, IL, USA). The subsequent steps were carried out as previously described (Kim et al., 2013). Western blotting Abs and HRP-conjugated anti-rabbit Abs were obtained from Santa Cruz Biotechnology, Inc. (Santa Cruz, CA, USA) and Sigma-Aldrich (St. Louis, Mo, USA), respectively.
Treatment of Pharmacological Inhibitor and PGE2 Receptor Blockers
Following pre-treatment with Cox-2 inhibitor (celecoxib; 1 μM) or PGE2 receptor blockers (1 μg/ml each of anti-EP2 and -EP4 mAb) for 1 h, cells were infected with MAH (MOI of 1) in the presence or absence of LPS treatment for 24 h at 37°C, and IL-10 concentration was evaluated by ELISA. Cox-2 inhibitor and PGE2 receptor blockers were obtained from Sigma-Aldrich and Abcam (Cambridge, MA, USA), respectively.
Statistical Analysis
Levels of significance of the differences between samples were determined by Tukey’s multiple comparison test and unpaired t-test using a statistical software (GraphPad Prism Software, version 5; GraphPad Software, San Diego, CA, USA). We performed a normality test using Shapiro-Wilk test. At the 0.05 level, all data were significantly drawn from a normally distributed population. The data in the graphs are expressed as the means. Results were considered to be statistically significant at *p < 0.05, **p < 0.01, or ***p < 0.001.
Results
Toll-Like Receptor4 Agonist Stimulation of Mycobacterium avium subspecies hominissuis-Infected Dendritic Cells Induces Marked Interleukin-10 Production
TLRs play key roles in host defense against various pathogens, which may contribute to the PAMP-induced signaling pathways (Mogensen, 2009). In order to study how co-infection of MAH and various pathogens affects cytokine production in DCs, we first confirmed the regulation of cytokine production (pro- and anti-inflammatory cytokines) in DCs following MAH infection for 2 h prior to stimulation with TLR agonist for 24 h (Figure 1A). Interestingly, MAH-infected DCs dramatically increased the levels of anti-inflammatory cytokine IL-10 in the presence of TLR4 agonist (LPS) stimulation, although this cytokine level was not significantly different in the presence of other TLR signaling molecules. The increased patterns of TNF-α and IL-12p70 levels were not shown. Next, we analyzed the regulation of cytokine production following TLR agonist treatment for 2 h prior to infection with MAH for 24 h (Figure 1B). TNF-α and IL-12p70 production in DCs, induced by the treatment of TLR2, 3, 4, 7, and 9 agonists, were strongly increased by MAH infection; IL-10 production in DCs, induced by the treatment of TLR3, 4, 7, and 9 agonists, was increased by MAH infection, but not in TLR2-treated DCs. Finally, we analyzed cytokine production in DCs following treatment with both MAH and TLR ligands (Figure 1C). As shown in Figure 1C, MAH-infected DCs had considerably higher levels of the anti-inflammatory cytokine IL-10 in the presence of TLR4 signaling (LPS stimulation), although this cytokine level was not significantly different in the presence of other TLR signaling molecules. TNF-α and IL-12p70 production, depicted in Figures 1A,C, showed similar patterns for treatment of all TLR agonists, although IL-10 levels strongly increased in Figure 1C (LPS treatment condition) than in Figures 1A,B. Based on these results, to investigate the role of excessive IL-10 production in DCs co-infected with MAH and TLR-stimulations, the method in Figure 1C was selected for further investigation. We also confirmed that the remarkable enhancement in IL-10 production in MAH-infected DCs exposed to LPS was not due to cytotoxicity, since there was no difference in Annexin V/PI positive cells and LDH release (Figures 1D,E). We also identified the above results using P. aeruginosa, a Gram-negative organism, which is reported to be a major co-infecting agent in patients with NTM-PD (Wickremasinghe et al., 2005), in order to confirm the specific immune response of MAH-infected DCs in real co-infection. P. aeruginosa PA01 and P. aeruginosa NCCP14781 were tested with the third method (followed in Figure 1C), and expression of IL-10 was explosively increased in the MAH/P. aeruginosa-infected DC (Supplementary Figure S1).
Figure 1
Mycobacterium avium subspecies hominissuis-Infected Dendritic Cells Induce Tolerogenic Phenotypes in the Presence of Toll-Like Receptor4 Signaling
The IL-10 production level is higher in tolerogenic DCs compared to in inflammatory DCs (Raker et al., 2015). Thus, we hypothesized that IL-10 production by MAH-infected DCs, upon stimulation with LPS, induces tolerogenic phenotypes. To validate this hypothesis, we analyzed the expression of surface molecules (CD80, CD86, MHC-I, and MHC-II) in each stimulation condition (non-, LPS-, MAH-, MAH/LPS-DCs) across the time-points (12 and 24 h). MAH-infected DCs exposed to LPS showed a lower expression of MHC-II than MAH-infected DCs at 24 h, but there was no significant change in CD80, CD86, and MHC-I expression (Figure 2A) at all time-points. These phenomena were not observed at an earlier time point (6 h; data not shown). We also measured the extracellular and intracellular cytokine levels in time-dependent manner. A significant up-regulation of extracellular IL-10 production occurred in MAH-infected DCs exposed to LPS in a time-dependent manner (Figure 2B). These results were confirmed by intracellular staining of cytokines, which revealed that MAH-infected DCs exposed to LPS stimulation exhibited higher intracellular IL-10 expression, but lower intracellular IL-12p70 expression, than LPS-treated DCs (Figure 2C). Since antigen-presenting ability is influenced by the expression of IL-10 and MHC class molecules regulated by DCs, we analyzed the antigen-presenting ability of MAH-infected DCs exposed to LPS signaling by the anti-Y-Ae mAb, which directly reacts with the Eα52–68 peptide MHC-II, and the anti-25-D1.16 mAb, which recognizes the OVA257–264 peptide bound to H-2Kb of MHC-I (Figure 3). In the study of antigen-presenting ability of non-treated DCs, MAH-infected DCs, LPS-treated DCs, and MAH-infected DCs exposed to LPS were treated with OVA protein or Eα44–76 peptide for 24 h, and then cells were stained with anti-Y-Ae (Figures 3A,C) or anti-25-D1.16 (Figures 3B,D) mAbs, respectively. Eα52–68 and OVA257–264 were used as the positive control for MHC-II or MHC-I bound peptides. As expected, a significantly lower percentage of OVA257–264/MHC-II complexes (Y-Ae-positive cells) were present in the MAH-infected DCs exposed to LPS compared to that in the MAH-infected DCs, or LPS-treated DCs (Figures 3A,C); a decrease of Eα52–68/MHC-I complex (25-D1.16-positive cells) was not observed (Figures 3B,D). These results, together with the strong increase in IL-10 production, reduction of MHC-II expression, and MHC-II antigen presentation, indicated that MAH infection endows DCs with a tolerogenic property in the presence of TLR4 signaling.
Figure 2
Figure 3
Mycobacterium avium subspecies hominissuis-Infected Dendritic Cells Reduce the Proliferation of CD4+ T Cells in the Presence of Toll-Like Receptor4 Signaling
As a next step, we investigated the reduction of T cell proliferation, induced during MAH-infection of DCs exposed to LPS, which can block the proliferation of naïve T cells (Domogalla et al., 2017). Thus, we performed a mixed lymphocyte reaction assay using OVA-specific T cells (Figures 4A,B) and allogeneic T cells (Figures 4C,D). Further details regarding the mixed lymphocyte reaction assay is provided in the section “Materials and Methods.” Interestingly, MAH-infected DCs exposed to LPS reduced the proliferation and Th1-type cytokine production (IFN-γ and IL-2) of OVA-specific (Figure 4A) and allogeneic (Figure 4C) CD4+ T cells compared to MAH-infected DCs and/or LPS-treated DCs, although not in CD8+ T cells (Figures 4B,D). These findings indicated that MAH-infected DCs exposed to LPS lead to the inhibitory effect of CD4+ T cell proliferation.
Figure 4
Interleukin-10 Neutralization for Mycobacterium avium subspecies hominissuis-Infected Dendritic Cells Exposed to LPS Induces Neither Tolerogenic Dendritic Cell Phenotypes nor Reduction in CD4+ T Cell Proliferation
Based on the above results, we hypothesized that if IL-10 production, induced by MAH-infected DCs exposed to LPS, is a primary factor for inducing tolerogenic DC phenotypes and reducing CD4+ T cell proliferation, the absence of IL-10 signaling should restore an activated DC phenotype and CD4+ T cell proliferation. First, to investigate whether the IL-10 induced by MAH-infected DCs exposed to LPS induces phenotypic and functional changes, we treated MAH-infected cells with an anti-IL-10 mAb and evaluated cytokine production, surface molecule expression, and antigen-presenting ability exposed to LPS stimulation. MAH-infected DCs exposed to LPS significantly abrogated IL-10 production, although IL-12p70 levels were increased in the presence of anti-IL-10 mAb. TNF-α production was not significantly different in the presence of anti-IL-10 mAb (Figure 5A). Moreover, incubation of the LPS/MAH-infected DCs (MAH-infected DCs exposed to LPS) with an anti-IL-10 mAb restored their MHC-II expression levels (Figure 5B, Supplementary Figure S2A) as well as antigen-presenting ability (Figure 5C, Supplementary Figure S2B) of MHC-II. Furthermore, we evaluated the capacity of IL-10-neutralized LPS/MAH-infected DCs to induce proliferation of allogenic CD4+ T cells using the same experimental conditions described in Figure 4C. As shown in Figure 5D, Supplementary Figure S2C, IL-10-neutralized LPS/MAH-infected DCs restored CD4+ T cell proliferation compared to rat IgG (isotype control Ab)-treated LPS/MAH-infected DCs. Collectively, these results indicated IL-10 signal as a key player in the tolerogenic phenotypes and activities induced by the MAH-infected DCs exposed to LPS.
Figure 5
Live Mycobacterium avium subspecies hominissuis Infection in Dendritic Cells is Essential for Both Toll-Like Receptor2 and Toll-Like Receptor4 Signaling-Mediated Interleukin-10 Production
Next, we examined whether excessive IL-10 production of LPS/MAH-infected DCs is regulated by live MAH infection, and DCs were exposed to inactivated MAH, killed by heat or PFA treatment, in the presence of LPS. Interestingly, lower levels of IL-10 were observed in the LPS/inactivated MAH-infected DCs than in LPS/MAH-infected DCs (Figure 6A). Moreover, we determined the regulation of IL-10 production in DCs isolated from WT, TLR2−/−, and TLR4−/− mice, since TLR2 and TLR4 receptors play critical roles in host immune system against MAH infection (Feng et al., 2003; Bhatnagar and Schorey, 2007). As shown in Figure 6B, the expression of TNF-α, IL-12p70, and IL-10 was induced by MAH-infected DCs exposed to LPS in the same manner as LPS-alone treatment in TLR2−/− and as MAH-alone infection in TLR4−/−. However, unlike other cytokines such as TNF-α and IL-12p70, IL-10 production was remarkably increased in the WT. These results suggested that both TLR2 and TLR4 signaling are essential for excessive IL-10 production induced by MAH-infected DCs exposed to LPS.
Figure 6
Activation of Cox-2 Pathways Mediates Excessive Interleukin-10 Production in Mycobacterium avium subspecies hominissuis-Infected Dendritic Cells Exposed to LPS
Mitogen-activated protein kinase (MAPK), nuclear factor kappa-B (NF-κB), and cyclooxygenase-2 (Cox2)/PGE2 signals regulate pro- and anti-inflammatory cytokine production during DC maturation (Harizi et al., 2002; Gabrysova et al., 2014). To examine whether these signals are involved in increased IL-10 production of LPS/MAH-infected DCs, the phosphorylated MAPKs (p-ERK, p-JNK, and p-p38), the phosphorylation/degradation of IκB-α, and Cox2 activation were investigated by western blot analysis (Figure 7A). LPS/MAH-infected DCs showed rapid ERK, JNK, and p38 phosphorylation compared to LPS-treated or MAH-infected DCs at early exposure time (15 min), but not in later exposure times (30 and 60 min). These results showed that MAPK and NF-κB signals are not the major pathways for IL-10 production, since IL-10 produced by LPS/MAH-infected DCs were not observed in 6-h exposure time. Interestingly, LPS/MAH-infected DCs promoted Cox2 activation and PGE2 expression compared to LPS-treated or MAH-infected DCs (Figures 7B,C). To confirm the involvement of Cox2/PGE2 activation in excessive IL-10 production, we next treated LPS/MAH-infected DCs with specific Cox2 inhibitor (celecoxib) and PGE2 receptor blockers (anti-EP2 and -EP4 mAbs) and then analyzed IL-10 production. Treatment of Cox2 inhibitor and EP2 blocker significantly abrogated IL-10 production in LPS/MAH-infected DCs (Figures 7D,E), suggesting Cox2/PGE2-dependent EP2 signaling as the main pathway for IL-10 production induced by MAH-infected DCs exposed to LPS.
Figure 7
Discussion
To date, pathogenesis and immune phenomena have been studied using single species of mycobacteria and applied to treatment guidelines; these studies have usually been limited to MTB. Here, we investigated the specific immune response and related major mechanisms by stimulating the different TLR agonists to mimic co-infection in MAH-infected DCs. MAH-infected DCs strongly increased IL-10 production when treated with the TLR4 agonist LPS compared to treatment with various other TLR agonists. LPS treatment induced tolerogenic phenotypes in MAH-infected DCs by significantly reducing the expression of MHC class II and MHC class II-antigen presentation and significantly increasing the production of extracellular and intracellular IL-10, thus inhibiting CD4+ T cell proliferation along with decreased IFN-γ and IL-2. The use of an anti-IL-10 neutralizing Ab also confirmed the recovery of all tolerogenic DC phenotypes described above. Interestingly, the expression of these tolerogenic DCs was observed following infection with live MAH, but not with inactivated MAH, and when TLR2 and TLR4 were co-involved. In addition, the tolerogenic phenotype in which MAH-infected DCs were induced by LPS treatment revealed that Cox2/PGE2-dependent EP2 signaling is a key pathway.
As shown in Figure 1A, the expression changes of TNF-α, IL-12p70, and IL-10 following TLR2, TLR3, TLR4, TLR7, and TLR9 agonist treatment in MAH-infected DCs were analyzed. Although there were differences in levels, TLR3 and TLR4 stimulation particularly decreased IL-12p70 expression and remarkably elevated IL-10 expression in MAH-infected DCs. There was a substantial increase in IL-10 expression following TLR4 stimulation (Figure 1C). As mentioned in the section “Introduction,” many studies have suggested P. aeruginosa, a Gram-negative organism, as the most frequent co-infecting agent in NTM infection (Wickremasinghe et al., 2005). TLR4 is one of the representative TLRs in P. aeruginosa, which has been shown to affect susceptibility phenotypes, such as increased inflammatory cytokine production, decreased iNOs and β-defensin-2 production, and bacterial elimination in TLR4-deficient mice (McIsaac et al., 2012). For further clarification, we identified changes in the expression of TNF-α, IL-12p70, and IL-10 in MAH-infected DCs co-infected with P. aeruginosa, and in particular, the expression of IL-10 dramatically increased, confirming that TLR4 signaling in MAH infected cells showed the same result as in the actual infection with Gram-negative bacteria (Supplementary Figure S1). In addition, we analyzed the expression changes of IL-10 production in TLR2−/-DCs and TLR4−/-DCs following MAH/LPS treatment (Figure 6B). The level of IL-10 expression was similar in that in MAH/LPS-infection and LPS-treatment of TLR2−/− DCs and in MAH/LPS-infection and MAH-infection of TLR4−/− DCs, whereas IL-10 production was strongly increased in MAH/LPS-infection in WT DCs. This level of IL-10 expression was greater than the sum of IL-10 production due to either MAH or LPS alone. These results collectively indicate that MAH infection and LPS stimulation interact and produce a synergistic reaction. TLR2 and TLR4 are thought to act together to express the phenotype of IL-10-expressing tolerogenic DC.
There have been several previous studies in which multiple TLRs have been shown to work together to induce totally new immune responses or to distort the existing immune responses. Along with TLR2, which is a major synergistic receptor that recognizes mycobacteria, TLR9 is essential for inducing Th1 responses (Bafica et al., 2005); however, according to Holscher et al. (2008), TLR2, TLR9, and MyD88 signaling has little influence on the induction of Th1 responses in MTB infection (Holscher et al., 2008). TLR6, TLR9, and MyD88 signaling has been shown to regulate M. avium infection; MyD88, in particular, plays an essential role in inducing a protective immune response (Carvalho et al., 2011; Marinho et al., 2013). In addition, Srivastava et al. (2009) had reported that MTB acts on TLR2 and dendritic cell-specific ICAM-3 grabbing non-integrin receptor (DC-SIGNR), and that suppressors of cytokine signaling (SOCS) was induced by the differential control of the two receptors depending on MTB virulence, thus impairing the defense against MTB (Srivastava et al., 2009). More importantly, TLR4,2-primed DCs enhanced IL-10 production by altering the balance of signaling pathways (via p38 MAPK, ERK1/2, and TNFR-associated factor 3) following TLR4 stimulation (Yanagawa and Onoe, 2007). MAPK p38 has been well established to be first involved in the production of IL-10 and IL-12 in response to LPS stimulation (Park et al., 2005). However, following TLR4 stimulation, IL-10 production is more significantly increased in TLR4,2-primed DCs than in TLR4-primed DCs, thereby suggesting that TLR2-mediated signaling contributes to the enhancement of IL-10 production capability (Yanagawa and Onoe, 2007). We can see similar results in Figure 6. TNF-α was expressed at the same level regardless of live, inactivated, or dead MAH infection; however, the expression of IL-12p70 and IL-10 was confirmed to be induced during the infection of live MAH (Figure 6A). In addition, since TLR2 and TLR4 were found to work together and boost the expression of IL-10 (Figure 6B), the TLR4 agonist, LPS, and the TLR2 ligand, expressed by live MAH, were thought to induce tolerogenic DC.
DCs are tightly regulated so as to induce protective immune responses and prevent exaggerated or unwanted immune responses (Corinti et al., 2001). IL-10 is an anti-inflammatory cytokine and a critical factor in inducing tolerogenic DCs, which subsequently impedes the Th1 response (Raker et al., 2015; Kim et al., 2017). The role of IL-10 in mycobacterial infection has been extensively studied. IL-10 has been shown to play an important role in immune regulation in host immunity; however, it is also known to be involved in anti-mycobacterial function, which can survive in both macrophages and DCs (Hussain et al., 2016). In the present study, the high level of IL-10 produced in LPS/MAH-infected DCs selectively promoted tolerogenic DCs by reducing MHC class II and MHC class II-antigen presentation and consequently inhibiting CD4+ T cell proliferation and IFN-γ and IL-2 expression (Figures 2–5). Finally, IL-12p70 expression was reduced in LPS/MAH-infected DCs, while IL-12p70 expression was restored using anti-IL-10, demonstrating that Th1 responses were inhibited by LPS/MAH stimulation (Figure 5). These findings clearly imply that the tolerogenic phenotype of DCs was induced by IL-10.
Various mechanisms have been reported to modulate IL-10 production. The major signaling pathways associated with IL-10 regulation and production include MAPKs, NF-κB, and signal transducer and activator of transcription-3 (STAT3) (Hussain et al., 2016). In particular, MAPK p38 plays an important role in overall signal cascades in mycobacterial infections (Reiling et al., 2001; Hussain et al., 2016). However, in this study, since IL-10 was produced after 6 h of LPS stimulation and MAPK (ERK, JNK, and p. 38) phosphorylation only occurred during the early exposure time (15 min), the MAPK signals were obviously not the major pathway involved in IL-10 production (Figure 7). The adapter MyD88, which acts downstream of TLR4, induces activation of NF-κB and MAP kinase using the adapter TIRAP (Takeuchi and Akira, 2010); TIR-domain-containing adapter-inducing interferon-β (TRIF) activates IRF3 as an adapter for TLR4 and TLR3 and induces expression of IFN-β and -α4 (Takeuchi and Akira, 2010). As mentioned above, TLR3 and TLR4 treatment of MAH-infected DCs showed similar results, indicating increased IL-10 expression and decreased IL-12p70 expression. Although previous studies have reported differences in TRIF-mediated DC maturation for type 1 IFN dependencies between TLR3 and TLR4 (Hu et al., 2015), our results indicated the involvement of TRIF signaling pathway downstream of TLR3 and TLR4.
In addition to IL-10, PGE2 is also produced in DCs and is known to exhibit immunosuppressive effects (Harizi and Gualde, 2006). Moreover, PGE2 has been reported to act on the EP receptor, a PGE2 receptor expressed on the surface of DCs, to increase internal cAMP, which ultimately increases endogenous IL-10 production (Harizi and Norbert, 2004). Cox2 has been reported to be highly expressed in DCs following LPS stimulation and is associated with the synthesis of large amounts of PGE2 (Harizi et al., 2002). Interestingly, Cox2 activation and PGE2 expression were significantly increased in LPS/MAH-infected DCs compared to LPS-treated or MAH-infected DC alone, and the production of IL-10 was remarkably inhibited by celecoxib, a Cox2 inhibitor, in the present study (Figure 7). Therefore, IL-10 expression was considered to be induced by Cox2-mediated PGE2 in MAH/LPS infected DCs. Of the four subtypes, cAMP has been reported to act on EP2 and EP4, IL-10 is increased in DCs, and EP2 increases IL-10 production in LPS-stimulated DCs (Harizi et al., 2003; Harizi and Gualde, 2006). Our results demonstrate the effect of EP2 blocker in reducing IL-10 production, thereby suggesting Cox2/PGE2-dependent EP2 signaling as the major mechanism involved in IL-10 production induction by LPS treatment in MAH-infected DCs. Therefore, the present study on tolerogenic DC phenotype, function, and related mechanisms induced by LPS/MAH-infected DCs may provide clues for understanding the altered immune responses in case of MAH co-infection.
Statements
Data availability statement
All relevant datasets are contained within the manuscript.
Ethics statement
This study was carried out in accordance with the regulation of “the Institutional Animal Care and Use Committee of the Yonsei University Health System” (Permit number: 2015-0203). The protocol was approved by “the Institutional Animal Care and Use Committee of the Yonsei University Health System.”
Author contributions
WK performed most of the experiments. WK, J-HY, M-KS, and SS conceived the study, analyzed the data, and wrote the manuscript. M-KS and SS critically revised the manuscript. All the authors discussed the results and commented on the manuscript.
Funding
This research was supported by Global Research Laboratory (GRL) Program (2016K1A1A2910779) and the Basic Science Research Program (2019R1A2C1006789) of the National Research Foundation (NRF) funded by the Ministry of Science, ICT (Information and Communication Technologies), Republic of Korea.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fmicb.2019.01795/full#supplementary-material
SUPPLEMENTARY FIGURE 1MAH-infected DCs induced high-level anti-inflammatory cytokine secretion during Pseudomonas aeruginosa infection. Immature DCs were treated with PBS (CON), MAH (at a MOI of 1), P. aeruginosa PA01 (at a MOI of 0.1, 0.5, and 1), P. aeruginosa NCCP14781 (at a MOI of 0.1, 0.5, and 1), or P. aeruginosa with MAH. After 24 h, culture supernatants were collected, and TNF-α, IL-12p70, and IL-10 productions were analyzed using ELISA. The data are expressed as the mean ± SD of 4 samples per treated condition. ***p < 0.001.
SUPPLEMENTARY FIGURE 2Gating strategy for the analysis of surface molecule expression, antigen presenting ability, and T cell proliferation by IL-10 neutralization in DCs treated with LPS and MAH. (A,B) DCs were treated with PBS (CON), LPS, MAH, or LPS with MAH, and then pulsed with a neutralizing ani-IL-10 mAb or rat IgG (isotype control) for 24 h. (A) Cells were stained with surface Abs (anti-CD80, anti-CD86, anti-MHC-I, anti-MHC-II) of DCs, and analyzed by flow cytometry. This result shows the flow cytometry gating strategy for Figure 5B. (B) In presence of neutralizing ani-IL-10 mAb or rat IgG, DCs were treated with PBS (CON), LPS, MAH, or LPS with MAH, and then exposed to Eα44–76 peptide or OVA257–264 (positive control) for 24 h. Cells were harvested and stained with ani-CD11c, and anti-Y-Ae or anti-25-D1.16 mAbs. Bar graph for the expression of Eα52–68/I-Ab complexes was derived from flow cytometry. This result shows the flow cytometry gating strategy for Figure 5C. (C) CD4+ T cells isolated from BALB/C (allogeneic mice) were stained with CFSE, and co-cultured for 96 h with DCs treated with PBS (CON), MAH, or LPS with MAH, in presence or absence of a neutralizing ani-IL-10 mAb or rat IgG. The proliferation of CD4+ was then assessed by flow cytometry. This result shows the flow cytometry gating strategy for Figure 5D.
References
1
BaficaA.ScangaC. A.FengC. G.LeiferC.CheeverA.SherA. (2005). TLR9 regulates Th1 responses and cooperates with TLR2 in mediating optimal resistance to Mycobacterium tuberculosis. J. Exp. Med.202, 1715–1724. doi: 10.1084/jem.20051782
2
BauerS.KirschningC. J.HackerH.RedeckeV.HausmannS.AkiraS.et al. (2001). Human TLR9 confers responsiveness to bacterial DNA via species-specific CpG motif recognition. Proc. Natl. Acad. Sci. USA98, 9237–9242. doi: 10.1073/pnas.161293498
3
BhatnagarS.SchoreyJ. S. (2007). Exosomes released from infected macrophages contain Mycobacterium avium glycopeptidolipids and are proinflammatory. J. Biol. Chem.282, 25779–25789. doi: 10.1074/jbc.M702277200
4
BonaitiG.PesciA.MarruchellaA.LapadulaG.GoriA.AlibertiS. (2015). Nontuberculous mycobacteria in noncystic fibrosis bronchiectasis. Biomed. Res. Int.2015:197950. doi: 10.1155/2015/197950
5
BryantC. E.SpringD. R.GangloffM.GayN. J. (2010). The molecular basis of the host response to lipopolysaccharide. Nat. Rev. Microbiol.8, 8–14. doi: 10.1038/nrmicro2266
6
CarvalhoN. B.OliveiraF. S.DuraesF. V.De AlmeidaL. A.FloridoM.PrataL. O.et al. (2011). Toll-like receptor 9 is required for full host resistance to Mycobacterium avium infection but plays no role in induction of Th1 responses. Infect. Immun.79, 1638–1646. doi: 10.1128/IAI.01030-10
7
CorintiS.AlbanesiC.La SalaA.PastoreS.GirolomoniG. (2001). Regulatory activity of autocrine IL-10 on dendritic cell functions. J. Immunol.166, 4312–4318. doi: 10.4049/jimmunol.166.7.4312
8
DomogallaM. P.RostanP. V.RakerV. K.SteinbrinkK. (2017). Tolerance through education: how tolerogenic dendritic cells shape immunity. Front. Immunol.8:1764. doi: 10.3389/fimmu.2017.01764
9
FengY.MuR.WangZ.XingP.ZhangJ.DongL.et al. (2019). A toll-like receptor agonist mimicking microbial signal to generate tumor-suppressive macrophages. Nat. Commun.10:2272. doi: 10.1038/s41467-019-10354-2
10
FengC. G.ScangaC. A.Collazo-CustodioC. M.CheeverA. W.HienyS.CasparP.et al. (2003). Mice lacking myeloid differentiation factor 88 display profound defects in host resistance and immune responses to Mycobacterium avium infection not exhibited by toll-like receptor 2 (TLR2)- and TLR4-deficient animals. J. Immunol.171, 4758–4764. doi: 10.4049/jimmunol.171.9.4758
11
FujitaK.ItoY.HiraiT.KuboT.TogashiK.IchiyamaS.et al. (2014). Prevalence and risk factors for chronic co-infection in pulmonary Mycobacterium avium complex disease. BMJ Open Respir. Res.1:e000050. doi: 10.1136/bmjresp-2014-000050
12
GabrysovaL.HowesA.SaraivaM.O’garraA. (2014). The regulation of IL-10 expression. Curr. Top. Microbiol. Immunol.380, 157–190. doi: 10.1007/978-3-662-43492-5_8
13
HariziH.GrossetC.GualdeN. (2003). Prostaglandin E2 modulates dendritic cell function via EP2 and EP4 receptor subtypes. J. Leukoc. Biol.73, 756–763. doi: 10.1189/jlb.1002483
14
HariziH.GualdeN. (2006). Pivotal role of PGE2 and IL-10 in the cross-regulation of dendritic cell-derived inflammatory mediators. Cell. Mol. Immunol.3, 271–277. PMID:
15
HariziH.JuzanM.PitardV.MoreauJ. F.GualdeN. (2002). Cyclooxygenase-2-issued prostaglandin e(2) enhances the production of endogenous IL-10, which down-regulates dendritic cell functions. J. Immunol.168, 2255–2263. doi: 10.4049/jimmunol.168.5.2255
16
HariziH.NorbertG. (2004). Inhibition of IL-6, TNF-alpha, and cyclooxygenase-2 protein expression by prostaglandin E2-induced IL-10 in bone marrow-derived dendritic cells. Cell. Immunol.228, 99–109. doi: 10.1016/j.cellimm.2004.04.003
17
HolscherC.ReilingN.SchaibleU. E.HolscherA.BathmannC.KorbelD.et al. (2008). Containment of aerogenic Mycobacterium tuberculosis infection in mice does not require MyD88 adaptor function for TLR2, −4 and −9. Eur. J. Immunol.38, 680–694. doi: 10.1002/eji.200736458
18
HsiehM. H.LinC. Y.WangC. Y.FangY. F.LoY. L.LinS. M.et al. (2018). Impact of concomitant nontuberculous mycobacteria and Pseudomonas aeruginosa isolates in non-cystic fibrosis bronchiectasis. Infect. Drug Resist.11, 1137–1143. doi: 10.2147/IDR.S169789
19
HuW.JainA.GaoY.DozmorovI. M.MandrajuR.WakelandE. K.et al. (2015). Differential outcome of TRIF-mediated signaling in TLR4 and TLR3 induced DC maturation. Proc. Natl. Acad. Sci. USA112, 13994–13999. doi: 10.1073/pnas.1510760112
20
HussainT.ShahS. Z.ZhaoD.SreevatsanS.ZhouX. (2016). The role of IL-10 in Mycobacterium avium subsp. paratuberculosis infection. Cell Commun. Signal14:29. doi: 10.1186/s12964-016-0152-z
21
JiaoX.Lo-ManR.GuermonprezP.FietteL.DeriaudE.BurgaudS.et al. (2002). Dendritic cells are host cells for mycobacteria in vivo that trigger innate and acquired immunity. J. Immunol.168, 1294–1301. doi: 10.4049/jimmunol.168.3.1294
22
JonesB. W.MeansT. K.HeldweinK. A.KeenM. A.HillP. J.BelisleJ. T.et al. (2001). Different toll-like receptor agonists induce distinct macrophage responses. J. Leukoc. Biol.69, 1036–1044. doi: 10.1189/jlb.69.6.1036
23
KimJ. S.KimW. S.ChoiH. G.JangB.LeeK.ParkJ. H.et al. (2013). Mycobacterium tuberculosis RpfB drives Th1-type T cell immunity via a TLR4-dependent activation of dendritic cells. J. Leukoc. Biol.94, 733–749. doi: 10.1189/jlb.0912435
24
KimH.KwonK. W.KimW. S.ShinS. J. (2017). Virulence-dependent induction of interleukin-10-producing-tolerogenic dendritic cells by Mycobacterium tuberculosis impedes optimal T helper type 1 proliferation. Immunology151, 177–190. doi: 10.1111/imm.12721
25
KunstH.WickremasingheM.WellsA.WilsonR. (2006). Nontuberculous mycobacterial disease and Aspergillus-related lung disease in bronchiectasis. Eur. Respir. J.28, 352–357. doi: 10.1183/09031936.06.00139005
26
MahlaR. S.ReddyM. C.PrasadD. V.KumarH. (2013). Sweeten PAMPs: role of sugar complexed PAMPs in innate immunity and vaccine biology. Front. Immunol.4:248. doi: 10.3389/fimmu.2013.00248
27
MarinhoF. A.De PaulaR. R.MendesA. C.De AlmeidaL. A.GomesM. T.CarvalhoN. B.et al. (2013). Toll-like receptor 6 senses Mycobacterium avium and is required for efficient control of mycobacterial infection. Eur. J. Immunol.43, 2373–2385. doi: 10.1002/eji.201243208
28
MatsumotoM.SeyaT. (2008). TLR3: interferon induction by double-stranded RNA including poly(I:C). Adv. Drug Deliv. Rev.60, 805–812. doi: 10.1016/j.addr.2007.11.005
29
McIsaacS. M.StadnykA. W.LinT. J. (2012). Toll-like receptors in the host defense against Pseudomonas aeruginosa respiratory infection and cystic fibrosis. J. Leukoc. Biol.92, 977–985. doi: 10.1189/jlb.0811410
30
MeierE.PenningtonK.Gallo De MoraesA.EscalanteP. (2017). Characteristics of Mycobacterium avium complex (MAC) pulmonary disease in previously treated lung cancer patients. Respir. Med. Case Rep.22, 70–73. doi: 10.1016/j.rmcr.2017.06.012
31
MogensenT. H. (2009). Pathogen recognition and inflammatory signaling in innate immune defenses. Clin. Microbiol. Rev.22, 240–273, Table of Contents. doi: 10.1128/CMR.00046-08
32
ParkJ. M.GretenF. R.WongA.WestrickR. J.ArthurJ. S.OtsuK.et al. (2005). Signaling pathways and genes that inhibit pathogen-induced macrophage apoptosis--CREB and NF-kappaB as key regulators. Immunity23, 319–329. doi: 10.1016/j.immuni.2005.08.010
33
PrevotsD. R.MarrasT. K. (2015). Epidemiology of human pulmonary infection with nontuberculous mycobacteria: a review. Clin. Chest Med.36, 13–34. doi: 10.1016/j.ccm.2014.10.002
34
QuesniauxV.FremondC.JacobsM.ParidaS.NicolleD.YeremeevV.et al. (2004). Toll-like receptor pathways in the immune responses to mycobacteria. Microbes Infect.6, 946–959. doi: 10.1016/j.micinf.2004.04.016
35
RakerV. K.DomogallaM. P.SteinbrinkK. (2015). Tolerogenic dendritic cells for regulatory T cell induction in man. Front. Immunol.6:569. doi: 10.3389/fimmu.2015.00569
36
ReilingN.BlumenthalA.FladH. D.ErnstM.EhlersS. (2001). Mycobacteria-induced TNF-alpha and IL-10 formation by human macrophages is differentially regulated at the level of mitogen-activated protein kinase activity. J. Immunol.167, 3339–3345. doi: 10.4049/jimmunol.167.6.3339
37
SauderD. N. (2000). Immunomodulatory and pharmacologic properties of imiquimod. J. Am. Acad. Dermatol.43, S6–S11. doi: 10.1067/mjd.2000.107808
38
SrivastavaV.ManchandaM.GuptaS.SinglaR.BeheraD.DasG.et al. (2009). Toll-like receptor 2 and DC-SIGNR1 differentially regulate suppressors of cytokine signaling 1 in dendritic cells during Mycobacterium tuberculosis infection. J. Biol. Chem.284, 25532–25541. doi: 10.1074/jbc.M109.006221
39
TakeuchiO.AkiraS. (2010). Pattern recognition receptors and inflammation. Cell140, 805–820. doi: 10.1016/j.cell.2010.01.022
40
ThomsonR. M. (2010). Changing epidemiology of pulmonary nontuberculous mycobacteria infections. Emerg. Infect. Dis.16, 1576–1583. doi: 10.3201/eid1610.091201
41
WerlingD.JannO. C.OffordV.GlassE. J.CoffeyT. J. (2009). Variation matters: TLR structure and species-specific pathogen recognition. Trends Immunol.30, 124–130. doi: 10.1016/j.it.2008.12.001
42
WickremasingheM.OzerovitchL. J.DaviesG.WodehouseT.ChadwickM. V.AbdallahS.et al. (2005). Non-tuberculous mycobacteria in patients with bronchiectasis. Thorax60, 1045–1051. doi: 10.1136/thx.2005.046631
43
YanagawaY.OnoeK. (2007). Enhanced IL-10 production by TLR4- and TLR2-primed dendritic cells upon TLR restimulation. J. Immunol.178, 6173–6180. doi: 10.4049/jimmunol.178.10.6173
44
YoshimuraA.LienE.IngallsR. R.TuomanenE.DziarskiR.GolenbockD. (1999). Cutting edge: recognition of Gram-positive bacterial cell wall components by the innate immune system occurs via toll-like receptor 2. J. Immunol.163, 1–5. PMID:
45
ZoumotZ.BoutouA. K.GillS. S.Van ZellerM.HansellD. M.WellsA. U.et al. (2014). Mycobacterium avium complex infection in non-cystic fibrosis bronchiectasis. Respirology19, 714–722. doi: 10.1111/resp.12287
Summary
Keywords
Mycobacterium avium subspecies hominissuis, dendritic cells, interleukin-10, toll-like receptor4, Cox-2/PGE2 signaling, EP2 receptor
Citation
Kim WS, Yoon J-H, Shin M-K and Shin SJ (2019) Infection of Dendritic Cells With Mycobacterium avium subspecies hominissuis Exhibits a Functionally Tolerogenic Phenotype in Response to Toll-Like Receptor Agonists via IL-10/Cox2/PGE2/EP2 Axis. Front. Microbiol. 10:1795. doi: 10.3389/fmicb.2019.01795
Received
06 March 2019
Accepted
22 July 2019
Published
07 August 2019
Volume
10 - 2019
Edited by
Joseph Alex Duncan, University of North Carolina at Chapel Hill, United States
Reviewed by
Shashank Gupta, Brown University, United States; Roberta Olmo Pinheiro, Oswaldo Cruz Foundation (Fiocruz), Brazil
Updates
Copyright
© 2019 Kim, Yoon, Shin and Shin.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Min-Kyoung Shin, mkshin@gnu.ac.krSung Jae Shin, sjshin@yuhs.ac
†These authors have contributed equally to this work
This article was submitted to Microbial Immunology, a section of the journal Frontiers in Microbiology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.